Wikia

Psychology Wiki

Neuromedin B

Talk0
31,726pages on
this wiki
Revision as of 20:21, December 17, 2012 by Dr Joe Kiff (Talk | contribs)

(diff) ← Older revision | Latest revision (diff) | Newer revision → (diff)

Assessment | Biopsychology | Comparative | Cognitive | Developmental | Language | Individual differences | Personality | Philosophy | Social |
Methods | Statistics | Clinical | Educational | Industrial | Professional items | World psychology |

Biological: Behavioural genetics · Evolutionary psychology · Neuroanatomy · Neurochemistry · Neuroendocrinology · Psychoneuroimmunology · Physiological Psychology · Psychopharmacology


neuromedin B
Symbol(s): NMB
Locus: 15 q11 -qter
EC number [1]
EntrezGene 4828
OMIM 162340
RefSeq NM_021077
UniProt P08949

Neuromedin B (NMB) is a Neuromedin and is a bombesin-related peptide in mammals.[1][2] It was originally purified from pig spinal cord, and later shown to be present in human central nervous system and gastrointestinal tract.[3]

Contents

Sequence Edit

The sequence of the C-terminal decapeptide is highly conserved across mammalian species: GNLWATGHFM-(NH2); this decapeptide is sometimes noted as neuromein B, but it is more accurately described as neuromedin B 23-32. The sequence of neuromedin B (in rat) is : TPFSWDLPEPRSRASKIRVHPRGNLWATGHFM-(NH2).[4]

Function Edit

File:Gpcr2.JPG
Figure 1: NMB, 7-TMR receptor and G-protein
File:Gpcr+cycle.JPG
Figure 2 : Signal Cascade after NMB binding

Neuromedin regulates the following functions:

  • exocrine and endocrine secretions
  • cell growth
  • body temperature
  • blood pressure and glucose level

Neuromedin signaling pathway Edit

NMB acts by binding to its high affinity cell surface receptor, neuromedin B receptor (NMBR). This receptor is a G protein-coupled receptor with seven transmembrane spanning regions, hence the receptor is also denoted as a 7-transmembrane receptor (7-TMR). Upon binding several intracellular signaling pathways are triggered (see Figure 2).

When NMB binds to its 7-TMR, the heterotrimeric G protein that is attached to the receptor is activated. The G-protein is called heterotrimeric because it consists of 3 polypeptides: α subunit, β subunit, and γ subunit. In the activated NMBR/G-protein complex, there occurs an exchange of GTP for GDP bound to G-α subunit. The G-α subunit, in turn, dissociated form the G-βγ subunits. The free G-α iactivates adenylate cyclase (AC), which, in turn, catalyzes the conversion of ATP to cAMP, the latter of which functioning as a second messenger. cAMP activates of the enzyme Protein Kinase A (PKA). PKA enters the nucleus and activates the cAMP response element-binding protein. The activated CREB binds along with CREB binding protein, co-activator to the CRE region of the DNA in the nucleus. CREB and CBP are held together by leucine zippers. CRE is the control that activates number of growth factors, and thus cell proliferation and some anti-apoptotic genes. In the brain, CREB plays a role in long-term memory and learning.

ReferencesEdit

  1. Ohki-Hamazaki H (October 2000). Neuromedin B. Prog. Neurobiol. 62 (3): 297–312.
  2. Jensen RT, Battey JF, Spindel ER, Benya RV (March 2008). International Union of Pharmacology. LXVIII. Mammalian bombesin receptors: nomenclature, distribution, pharmacology, signaling, and functions in normal and disease states. Pharmacol. Rev. 60 (1): 1–42.
  3. Krane IM, Naylor SL, Helin-Davis D, Chin WW, Spindel ER (15 September 1988). Molecular cloning of cDNAs encoding the human bombesin-like peptide neuromedin B. Chromosomal localization and comparison to cDNAs encoding its amphibian homolog ranatensin. J. Biol. Chem. 263 (26): 13317–23.
  4. Wada E, Way J, Lebacq-Verheyden AM, Battey JF (1 September 1990). Neuromedin B and gastrin-releasing peptide mRNAs are differentially distributed in the rat nervous system. J. Neurosci. 10 (9): 2917–30.

External linksEdit


This page uses Creative Commons Licensed content from Wikipedia (view authors).
Advertisement | Your ad here

Photos

Add a Photo
6,465photos on this wiki
See all photos >

Recent Wiki Activity

See more >

Around Wikia's network

Random Wiki