Psychology Wiki
Advertisement

Assessment | Biopsychology | Comparative | Cognitive | Developmental | Language | Individual differences | Personality | Philosophy | Social |
Methods | Statistics | Clinical | Educational | Industrial | Professional items | World psychology |

Biological: Behavioural genetics · Evolutionary psychology · Neuroanatomy · Neurochemistry · Neuroendocrinology · Neuroscience · Psychoneuroimmunology · Physiological Psychology · Psychopharmacology (Index, Outline)



Corticotropin-releasing hormone (CRH), originally named corticotropin-releasing factor (CRF), and also called corticoliberin, is a polypeptide hormone and neurotransmitter involved in the stress response.

Corticotropin-releasing hormone (CRH) is a 41-amino acid peptide derived from a 191-amino acid preprohormone. CRH is secreted by the paraventricular nucleus (PVN) of the hypothalamus in response to stress. Marked reduction in CRH has been observed in association with Alzheimer's disease, and autosomal recessive hypothalamic corticotropin deficiency has multiple and potentially-fatal metabolic consequences including hypoglycemia and hepatitis. In addition to being produced in the hypothalamus, CRH is also synthesized in peripheral tissues, such as T lymphocytes, and is highly expressed in the placenta. In the placenta, CRH is a marker that determines the length of gestation and the timing of parturition and delivery. A rapid increase in circulating levels of CRH occurs at the onset of parturition, suggesting that, in addition to its metabolic functions, CRH may act as a trigger for parturition.[1]

Hormonal actions[]

CRH is produced by neuroendocrine cells in the paraventricular nucleus of the hypothalamus and is released from neurosecretory terminals of these neurons into the primary capillary plexus of the hypothalamo-hypophyseal portal system. The portal system carries the CRH to the anterior lobe of the pituitary, where it stimulates corticotropes to secrete corticotropin (ACTH) and other biologically-active substances (for example β-endorphin).

α-helical CRH-(9–41) acts as a CRH antagonist.[2]

Psychopharmacy[]

The CRH-1 receptor antagonist pexacerfont is currently under investigation for the treatment of Generalized anxiety disorder in women.[3] Another CRH-1 antagonist antalarmin has been researched in animal studies for the treatment of anxiety, depression and other conditions, but no human trials with this compound have been carried out.

Also, abnormal levels of CRH have been found in the cerebrospinal fluid of suicide victims.[4]

Recent research has linked the activation of the CRH1 receptor with the euphoric feelings that accompany alcohol consumption. A CRH1 receptor antagonist developed by Pfizer, CP-154,526 is under investigation for the potential treatment of alcoholism.[5][6]

Role in parturition[]

CRH is also synthesized by the placenta and seems to determine the duration of pregnancy.[7]

Levels rise towards birth and current theory suggests three roles of CRH in parturition:[8]

  • Increases level so dehydroepiandrosterone (DHEA) directly by action on the fetal adrenal gland, and indirectly via the mother's pituitary gland. DHEA has a role in preparing for and stimulating cervical contractions.
  • Increases prostaglandin availability in uteroplacental tissues. Prostaglandins activate cervical contractions.
  • Prior to parturition it may have a role inhibiting contractions, through increasing cAMP levels in the myometrium.

In culture, trophoblast CRH is inhibited by progesterone, which remains high throughout pregnancy. Its release is stimultated by glucocorticoids and catecholamines, which increase prior to parturition lifting this progesterone block.[9]

Structure[]

The 41-amino acid sequence of CRH was first discovered in sheep by Vale et al in 1981.[10] Its full sequence is:

  • SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA

See also[]

References[]

  1. Entrez Gene: CRH corticotropin releasing hormone.
  2. Santos J, Saunders PR, Hanssen NP, Yang PC, Yates D, Groot JA, Perdue MH (August 1999). Corticotropin-releasing hormone mimics stress-induced colonic epithelial pathophysiology in the rat. Am. J. Physiol. 277 (2 Pt 1): G391–9.
  3. Study of Pexacerfont (BMS-562086) in the Treatment of Outpatients With Generalized Anxiety Disorder. ClinicalTrials.gov. URL accessed on 2008-08-03.
  4. Arató M, Bánki CM, Bissette G, Nemeroff CB (1989). Elevated CSF CRF in suicide victims. Biol. Psychiatry 25 (3): 355–9.
  5. Drug Has Potential To Prevent Alcoholics From Relapsing. Science News. ScienceDaily. URL accessed on 2008-08-09.
  6. Pastor R, McKinnon CS, Scibelli AC, Burkhart-Kasch S, Reed C, Ryabinin AE, Coste SC, Stenzel-Poore MP, Phillips TJ (July 2008). Corticotropin-releasing factor-1 receptor involvement in behavioral neuroadaptation to ethanol: a urocortin1-independent mechanism. Proc. Natl. Acad. Sci. U.S.A. 105 (26): 9070–5.
  7. Kimball JW. Hormones of the Hypothalamus. Kimball's Biology Pages. URL accessed on 2008-08-03.
  8. Lye S, Challis JRG (2001). "Chapter 12: Parturition" Bocking AD, Harding R Fetal growth and development, pages 241-266, Cambridge, UK: Cambridge University Press.
  9. Jones SA, Brooks AN, Challis JR (April 1989). Steroids modulate corticotropin-releasing hormone production in human fetal membranes and placenta. J. Clin. Endocrinol. Metab. 68 (4): 825–30.
  10. Vale W, Spiess J, Rivier C, Rivier J (September 1981). Characterization of a 41-residue ovine hypothalamic peptide that stimulates secretion of corticotropin and beta-endorphin. Science (journal) 213 (4514): 1394–7.

Further reading[]


  • Florio P, Severi FM, Ciarmela P, et al. (2003). Placental stress factors and maternal-fetal adaptive response: the corticotropin-releasing factor family.. Endocrine 19 (1): 91-102.
  • Florio P, Rossi M, Sigurdardottir M, et al. (2004). Paracrine regulation of endometrial function: interaction between progesterone and corticotropin-releasing factor (CRF) and activin A.. Steroids 68 (10-13): 801-7.
  • Vamvakopoulos NC, Karl M, Mayol V, et al. (1990). Structural analysis of the regulatory region of the human corticotropin releasing hormone gene.. FEBS Lett. 267 (1): 1-5.
  • Robinson BG, D'Angio LA, Pasieka KB, Majzoub JA (1989). Preprocorticotropin releasing hormone: cDNA sequence and in vitro processing.. Mol. Cell. Endocrinol. 61 (2): 175-80.
  • Arbiser JL, Morton CC, Bruns GA, Majzoub JA (1988). Human corticotropin releasing hormone gene is located on the long arm of chromosome 8.. Cytogenet. Cell Genet. 47 (3): 113-6.
  • Sasaki A, Tempst P, Liotta AS, et al. (1988). Isolation and characterization of a corticotropin-releasing hormone-like peptide from human placenta.. J. Clin. Endocrinol. Metab. 67 (4): 768-73.
  • Shibahara S, Morimoto Y, Furutani Y, et al. (1984). Isolation and sequence analysis of the human corticotropin-releasing factor precursor gene.. EMBO J. 2 (5): 775-9.
  • Behan DP, Heinrichs SC, Troncoso JC, et al. (1995). Displacement of corticotropin releasing factor from its binding protein as a possible treatment for Alzheimer's disease.. Nature 378 (6554): 284-7.
  • Kawahito Y, Sano H, Mukai S, et al. (1996). Corticotropin releasing hormone in colonic mucosa in patients with ulcerative colitis.. Gut 37 (4): 544-51.
  • McLean M, Bisits A, Davies J, et al. (1995). A placental clock controlling the length of human pregnancy.. Nat. Med. 1 (5): 460-3.
  • Slominski A, Ermak G, Hwang J, et al. (1995). Proopiomelanocortin, corticotropin releasing hormone and corticotropin releasing hormone receptor genes are expressed in human skin.. FEBS Lett. 374 (1): 113-6.
  • Sutton SW, Behan DP, Lahrichi SL, et al. (1995). Ligand requirements of the human corticotropin-releasing factor-binding protein.. Endocrinology 136 (3): 1097-102.
  • Vamvakopoulos NC, Chrousos GP (1994). Structural organization of the 5' flanking region of the human corticotropin releasing hormone gene.. DNA Seq. 4 (3): 197-206.
  • Perrin MH, Donaldson CJ, Chen R, et al. (1994). Cloning and functional expression of a rat brain corticotropin releasing factor (CRF) receptor.. Endocrinology 133 (6): 3058-61.
  • Romier C, Bernassau JM, Cambillau C, Darbon H (1993). Solution structure of human corticotropin releasing factor by 1H NMR and distance geometry with restrained molecular dynamics.. Protein Eng. 6 (2): 149-56.
  • Liaw CW, Grigoriadis DE, Lovenberg TW, et al. (1997). Localization of ligand-binding domains of human corticotropin-releasing factor receptor: a chimeric receptor approach.. Mol. Endocrinol. 11 (7): 980-5.
  • Timpl P, Spanagel R, Sillaber I, et al. (1998). Impaired stress response and reduced anxiety in mice lacking a functional corticotropin-releasing hormone receptor 1.. Nat. Genet. 19 (2): 162-6.
  • Perone MJ, Murray CA, Brown OA, et al. (1998). Procorticotrophin-releasing hormone: endoproteolytic processing and differential release of its derived peptides within AtT20 cells.. Mol. Cell. Endocrinol. 142 (1-2): 191-202.
  • Willenberg HS, Bornstein SR, Hiroi N, et al. (2000). Effects of a novel corticotropin-releasing-hormone receptor type I antagonist on human adrenal function.. Mol. Psychiatry 5 (2): 137-41.
  • Saeed B, Fawcett M, Self C (2001). Corticotropin-releasing hormone binding to the syncytiotrophoblast membranes.. Eur. J. Clin. Invest. 31 (2): 125-30.




Further references[]

  • Adamec, R. E., & McKay, D. (1993). The effects of CRF and !a-helical CRF on anxiety in normal and hypophysectomized rats: Journal of Psychopharmacology Vol 7(4) 1993, 346-354.
  • Adinoff, B., Cantey Kisser, J. M., Martin, P. R., & Linnoila, M. (1996). Response of dehydroepiandrosterone to corticotropin-releasing hormone stimulation in alcohol-dependent subjects: Biological Psychiatry Vol 40(12) Dec 1996, 1305-1307.
  • Agarwal, A., Halvorson, L. M., & Legradi, G. (2005). Pituitary adenylate cyclase-activating polypeptide (PACAP) mimics neuroendocrine and behavioral manifestations of stress: Evidence for PKA-mediated expression of the corticotropin-releasing hormone (CRH) gene: Molecular Brain Research Vol 138(1) Jul 2005, 45-57.
  • Aird, F., Halasz, I., & Redei, E. (1997). Ontogeny of hypothalamic corticotropin-releasing factor and anterior pituitary pro-opiomelanocortin expression in male and female offspring of alcohol-exposed and adrenalectomized dams: Alcoholism: Clinical and Experimental Research Vol 21(9) Dec 1997, 1560-1566.
  • Albeck, D. S., McKittrick, C. R., Blanchard, D. C., Blanchard, R. J., & et al. (1997). Chronic social stress alters levels of corticotropin-releasing factor and arginine vasopressin mRNA in rat brain: Journal of Neuroscience Vol 17(12) Jun 1997, 4895-4903.
  • Aloisi, A. M., Bianchi, M., Lupo, C., Sacerdote, P., & Farabollini, F. (1999). Neuroendocrine and behavioral effects of CRH blockade and stress in male rats: Physiology & Behavior Vol 66(3) May 1999, 523-528.
  • Alonso, R., Griebel, G., Pavone, G., Stemmelin, J., Le Fur, G., & Soubrie, P. (2004). Blockade of CRF-sub-1 or V-sub(1b) receptors reverses stress-induced suppression of neurogenesis in a mouse model of depression: Molecular Psychiatry Vol 9(3) Mar 2004, 278-286.
  • Altamura, A. C. (1996). Hypothalamic-pituitary-adrenal axis in schizophrenia: Biological Psychiatry Vol 40(6) Sep 1996, 560-561.
  • Amar, S. (2006). Stress and Inflammation: A Bidirectional Relationship. Malden, MA: Blackwell Publishing.
  • An, S.-J., Park, S.-K., Hwang, I.-K., Kim, H. S., Seo, M.-O., Suh, J.-G., et al. (2003). Altered corticotropin-releasing factor (CRF) receptor immunoreactivity in the gerbil hippocampal complex following spontaneous seizure: Neurochemistry International Vol 43(1) Jul 2003, 39-45.
  • Anderson, S. M., Kant, G. J., & de Souza, E. B. (1993). Effects of chronic stress on anterior pituitary and brain corticotropin-releasing factor receptors: Pharmacology, Biochemistry and Behavior Vol 44(4) Apr 1993, 755-761.
  • Anismana, H., Prakash, P., Merali, Z., & Poulter, M. O. (2007). Corticotropin releasing hormone receptor alterations elicited by acute and chronic unpredictable stressor challenges in stressor-susceptible and resilient strains of mice: Behavioural Brain Research Vol 181(2) Aug 2007, 180-190.
  • Arborelius, L., Skelton, K. H., Thrivikraman, K. V., Plotsky, P. M., Schulz, D. W., & Owens, M. J. (2000). Chronic administration of the selective corticotropin-releasing factor 1 receptor antagonist CP-154,526: Behavioral, endocrine and neurochemical effects in the rat: Journal of Pharmacology and Experimental Therapeutics Vol 294(2) Aug 2000, 588-597.
  • Armando, I., Volpi, S., Aguilera, G., & Saavedra, J. M. (2007). Angiotensin II AT-sub-1 receptor blockade prevents the hypothalamic corticotropin-releasing factor response to isolation stress: Brain Research Vol 1142 Apr 2007, 92-99.
  • Aubry, J. M., Bartanusz, V., Jezova, D., Belin, D., & Kiss, J. Z. (1999). Single Stress Induces Long-Lasting Elevations in Vasopressin mRNA Levels in CRF Hypophysiotrophic Neurones, but Repeated Stress is Required to Modify AVP Immunoreactivity: Journal of Neuroendocrinology Vol 11(5) May 1999, 377-384.
  • Austin, M. C., Janosky, J. E., & Murphy, H. A. (2003). Increased corticotropin-releasing hormone immunoreactivity in monoamine-containing pontine nuclei of depressed suicide men: Molecular Psychiatry Vol 8(3) 2003, 324-332.
  • Austin, M. C., Rhodes, J. L., & Lewis, D. A. (1997). Differential distribution of corticotropin-releasing hormone immunoreactive axons in monoaminergic nuclei of the human brainstem: Neuropsychopharmacology Vol 17(5) Nov 1997, 326-341.
  • Bailly, D., Servant, D., Dewailly, D., Beuscart, R., & et al. (1994). Corticotropin releasing factor stimulation test in obsessive compulsive disorder: Biological Psychiatry Vol 35(2) Jan 1994, 143-146.
  • Baker, D. G., Nicholson, W. E., Ekhator, N. A., Kasckow, J. W., Hill, K. K., Bruce, A. B., et al. (1999). "Serial CSF corticotropin-releasing hormone levels and adrenocortical activity in combat veterans with posttraumatic stress disorder": Correction: American Journal of Psychiatry Vol 156(6) Jun 1999, 986.
  • Baker, D. G., West, S. A., Nicholson, W. E., Ekhator, N. N., Kasckow, J. W., Hill, K. K., et al. (1999). Serial CSF corticotropin-releasing hormone levels and adrenocortical activity in combat veterans with posttraumatic stress disorder: American Journal of Psychiatry Vol 156(4) Apr 1999, 585-588.
  • Bakshi, V. P., & Kalin, N. H. (2000). Corticotropin-releasing hormone and animal models of anxiety: Gene-environment interactions: Biological Psychiatry Vol 48(12) Dec 2000, 1175-1198.
  • Bale, T. L. (2005). Sensitivity to stress: Dysregulation of CRF pathways and disease development: Hormones and Behavior Vol 48(1) Jun 2005, 1-10.
  • Bale, T. L. (2006). Stress sensitivity and the development of affective disorders: Hormones and Behavior Vol 50(4) Nov 2006, 529-533.
  • Bale, T. L., Picetti, R., Contarino, A., Koob, G. F., Vale, W. W., & Lee, K.-F. (2002). Mice deficient for both corticotropin-releasing factor receptor 1 (CRFR1) and CRF2 have an impaired stress response and display sexually dichotomous anxiety-like behavior: Journal of Neuroscience Vol 22(1) Jan 2002, 193-199.
  • Bale, T. L., & Vale, W. W. (2003). Increased Depression-Like Behaviors in Corticotropin- Releasing Factor Receptor-2-Deficient Mice: Sexually Dichotomous Responses: Journal of Neuroscience Vol 23(12) Jun 2003, 5295-5301.
  • Bale, T. L., & Vale, W. W. (2004). CRF and CRF receptors: Role in stress responsivity and other behaviors: Annual Review of Pharmacology and Toxicology Vol 44 2004, 525-557.
  • Banki, C., Karmacsi, L., Bissette, G., & Nemeroff, C. B. (1992). CSF corticotropin-releasing hormone and somatostatin in major depression: Response to antidepressant treatment and relapse: European Neuropsychopharmacology Vol 2(2) Jun 1992, 107-113.
  • Bao, A. M., Fischer, D. F., Wu, Y. H., Hol, E. M., Balesar, R., Unmehopa, U. A., et al. (2006). A direct androgenic involvement in the expression of human corticotropin-releasing hormone: Molecular Psychiatry Vol 11(6) Jun 2006, 567-576.
  • Bao, A.-M., Hestiantoro, A., Van Someren, E. J. W., Swaab, D. F., & Zhou, J.-N. (2005). Colocalization of corticotropin-releasing hormone and oestrogen receptor-alpha in the paraventricular nucleus of the hypothalamus in mood disorders: Brain: A Journal of Neurology Vol 128(6) Jun 2005, 1301-1313.
  • Bartanusz, V., Muller, D., Gaillard, R. C., Streit, P., Vutskits, L., & Kiss, J. Z. (2004). Local gamma -aminobutyric acid and glutamate circuit control of hypophyseotrophic corticotropin-releasing factor neuron activity in the paraventricular nucleus of the hypothalamus: European Journal of Neuroscience Vol 19(3) Feb 2004, 777-782.
  • Basso, A. M., Spina, M., Rivier, J., Vale, W., & Koob, G. F. (1999). Corticotropin-releasing factor antagonist attenuates the "anxiogenic-like" effect in the defensive burying paradigm but not in the elevated plus-maze following chronic cocaine in rats: Psychopharmacology Vol 145(1) Jul 1999, 21-30.
  • Basta-Kaim, A., Budziszewska, B., Jaworska-Feil, L., Tetich, M., Kubera, M., Leskiewicz, M., et al. (2005). Inhibitory effect of imipramine on the human corticotropin-releasing-hormone gene promoter activity operates through a PI3-K/AKT mediated pathway: Neuropharmacology Vol 49(2) Aug 2005, 156-164.
  • Basta-Kaim, A., Budziszewska, B., Jaworska-Feil, L., Tetich, M., Kubera, M., Leskiewicz, M., et al. (2006). Antipsychotic drugs inhibit the human corticotropin-releasing-hormone gene promoter activity in Neuro-2A cells--An involvement of protein kinases: Neuropsychopharmacology Vol 31(4) Apr 2006, 853-865.
  • Bauminger, S., Hughes, D., Naccari, C., & Wong, S. (2005). Noteworthy Briefs From the Field: Primary Psychiatry Vol 12(2) Feb 2005, 14-16.
  • Becker, L. A., & Hennessy, M. B. (1993). Further characterization of the behavioral effects of peripherally administered corticotropin-releasing factor in guinea pigs: Pharmacology, Biochemistry and Behavior Vol 44(4) Apr 1993, 925-930.
  • Behan, D. P., Heinrishs, S. C., Troncoso, J. C., Liu, X.-J., & et al. (1995). Displacement of corticotropin releasing factor from its binding protein as possible treatment for Alzheimer's disease: Nature Vol 378(6554) Nov 1995, 284-287.
  • Bell, S. M., Reynolds, J. G., Thiele, T. E., Gan, J., Figlewicz, D. P., & Woods, S. C. (1998). Effects of third intracerebroventricular injections of corticotropin-releasing factor (CRF) on ethanol drinking and food intake: Psychopharmacology Vol 139(1-2) Sep 1998, 128-135.
  • Benoit, S. C., Thiele, T. E., Heinrichs, S. C., Rushing, P. A., Blake, K. A., & Steeley, R. J. (2000). Comparison of central administration of corticotropin-releasing hormone and urocortin on food intake, conditioned taste aversion, and c-Fos expression: Peptides Vol 21(3) Mar 2000, 345-351.
  • Bierwolf, C., Struve, K., Marshall, L., Born, J., & Fehm, H. L. (1997). Slow Wave Sleep Drives Inhibition of Pituitary-Adrenal Secretion in Humans: Journal of Neuroendocrinology Vol 9(6) Jun 1997, 479-484.
  • Birmaher, B., Dahl, R. E., Perel, J., Williamson, D. E., & et al. (1996). Corticotropin-releasing hormone challenge in prepubertal major depression: Biological Psychiatry Vol 39(4) Feb 1996, 267-277.
  • Bissette, G. (2001). Effects of sertraline on regional neuropeptide concentrations in olfactory bulbectomized rats: Pharmacology, Biochemistry and Behavior Vol 69(1-2) May-Jun 2001, 269-281.
  • Bissette, G., Klimek, V., Pan, J., Stockmeier, C., & Ordway, G. (2003). Elevated concentrations of CRF in the locus coeruleus of depressed subjects: Neuropsychopharmacology Vol 28(7) Jul 2003, 1328-1335.
  • Bittencourt, J. C., & Sawchenko, P. E. (2000). Do centrally administered neuropeptides access cognate receptors?: An analysis in the central corticotropin-releasing factor system: Journal of Neuroscience Vol 20(3) Feb 2000, 1142-1156.
  • Blank, T., Nijholt, I., Eckart, K., & Spiess, J. (2002). Priming of long-term potentiation in mouse hippocampus by corticotropin-releasing factor and acute stress: Implications for hippocampus-dependent learning: Journal of Neuroscience Vol 22(9) May 2002, 3788-3794.
  • Blank, T., Nijholt, I., Grammatopoulos, D. K., Randeva, H. S., Hillhouse, E. W., & Spiess, J. (2003). Corticotropin-Releasing Factor Receptors Couple to Multiple G-Proteins to Activate Diverse Intracellular Signaling Pathways in Mouse Hippocampus: Role in Neuronal Excitability and Associative Learning: Journal of Neuroscience Vol 23(2) Jan 2003, 700-707.
  • Blank, T., Nijholt, I., Vollstaedt, S., & Spiess, J. (2003). The corticotropin-releasing factor receptor 1 antagonist CP-154,526 reverses stress-induced learning deficits in mice: Behavioural Brain Research Vol 138(2) Jan 2003, 207-213.
  • Blatchford, K. E., Choi, E. A., & McNally, G. P. (2006). Altered Responsivity to Central Administrations of Corticotropin-Releasing Factor in Rats With a History of Opiate Exposures: Behavioral Neuroscience Vol 120(5) Oct 2006, 1169-1174.
  • Blomeyer, D., Treutlein, J., Esser, G., Schmidt, M. H., Schumann, G., & Laucht, M. (2008). Interaction between CRHR1 gene and stressful life events predicts adolescent heavy alcohol use: Biological Psychiatry Vol 63(2) Jan 2008, 146-151.
  • Boadle-Biber, M. C., Singh, V. B., Corley, K. C., Phan, T.-h., & et al. (1993). Evidence that corticotropin-release factor within the extended amygdala mediates the activation of tryptophan hydroxylase produced by sound stress in the rat: Brain Research Vol 628(1-2) Nov 1993, 105-114.
  • Bonaz, B., & Tache, Y. (1994). Water-avoidance stress-induced c-fos expression in the rat brain and stimulation of fecal output: Role of corticotropin-releasing factor: Brain Research Vol 641(1) Mar 1994, 21-28.
  • Bowers, L. K., Swisher, C. B., & Behbehani, M. M. (2003). Membrane and synaptic effects of corticotropin-releasing factor on periaqueductal gray neurons of the rat: Brain Research Vol 981(1-2) Aug 2003, 52-57.
  • Brady, L. S. (1994). Stress, antidepressant drugs, and the locus coeruleus: Brain Research Bulletin Vol 35(5-6) 1994, 545-556.
  • Brambilla, F., Maggioni, M., Cenacchi, T., Sacerdote, P., & Panerai, A. R. (1995). T-lymphocyte proliferative response to mitogen stimulation in elderly depressed patients: Journal of Affective Disorders 36(1-2) Dec 1995, 51-56.
  • Brauns, O., Brauns, S., Jenke, M., Zimmermann, B., & Dautzenberg, F. M. (2002). Secondary structure of antisauvagine analogues is important for CFR receptor antagonism: Development of antagonists with increased potency and receptor selectivity: Peptides Vol 23(10) Oct 2002, 1817-1827.
  • Brauns, O., Liepold, T., Radulovic, J., & Spiess, J. (2001). Pharmacological and chemical properties of astressin, antisauvagine-30 and alpha -helCRF: Significance for behavioral experiments: Neuropharmacology Vol 41(4) Sep 2001, 507-516.
  • Bremner, J. D., Licinio, J., Darnell, A., Krystal, J. H., & et al. (1997). Elevated CSF corticotropin-releasing factor concentrations in posttraumatic stress disorder: American Journal of Psychiatry Vol 154(5) May 1997, 624-629.
  • Brewer, J. A., Bethin, K. E., Schaefer, M. L., Muglia, L. M., Vogt, S. K., Weninger, S. C., et al. (2003). Dissecting Adrenal and Behavioral Responses to Stress by Targeted Gene Inactivation in Mice: Stress: The International Journal on the Biology of Stress Vol 6(2) May 2003, 121-125.
  • Britton, K. T., Akwa, Y., Spina, M. G., & Koob, G. F. (2000). Neuropeptide Y blocks anxiogenic-like behavioral action of corticotropin-releasing factor in an operant conflict test and elevated plus maze: Peptides Vol 21(1) 2000, 37-44.
  • Broadbear, J. H., Winger, G., Cicero, T. J., & Woods, J. H. (1999). Effects of response contingent and noncontingent cocaine injection on hypothalamic-pituitary-adrenal activity in rhesus monkeys: Journal of Pharmacology and Experimental Therapeutics Vol 290(1) Jul 1999, 393-402.
  • Broadbear, J. H., Winger, G., Rice, K. C., & Woods, J. H. (2002). Antalarmin, a putative CRH-RI antagonist, has transient reinforcing effects in rhesus monkeys: Psychopharmacology Vol 164(3) Nov 2002, 268-276.
  • Broadbear, J. H., Winger, G., Rivier, J. E., Rice, K. C., & Woods, J. H. (2004). Corticotropin-Releasing Hormone Antagonists, Astressin B and Antalarmin: Differing Profiles of Activity in Rhesus Monkeys: Neuropsychopharmacology Vol 29(6) Jun 2004, 1112-1121.
  • Broadbear, J. H., Winger, G., & Woods, J. H. (1999). Cocaine-reinforced responding in rhesus monkeys: Pharmacological attenuation of the hypothalamic-pituitary-adrenal axis response: Journal of Pharmacology and Experimental Therapeutics Vol 290(3) Sep 1999, 1347-1355.
  • Brouxhon, S. M., Prasad, A. V., Joseph, S. A., Felten, D. L., & Bellinger, D. L. (1998). Localization of corticotropin-releasing factor in primary and secondary lymphoid organs of the rat: Brain, Behavior, and Immunity Vol 12(2) Jun 1998, 107-122.
  • Brown, E. R., & Sawchenko, P. E. (1997). Hypophysiotropic CRF Neurons Display a Sustained Immediate-Early Gene Response to Chronic Stress but not to Adrenalectomy: Journal of Neuroendocrinology Vol 9(4) Apr 1997, 307-316.
  • Brugger, S., Sanchez, R., Brugger, A. J., & Martinez, J. A. (1998). ICV administration of CRF blocker (CRF-sub(9-41 ) delta helical) reduces morphine withdrawal in rats: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 22(5) Jul 1998, 775-785.
  • Bruijnzeel, A. W., & Gold, M. S. (2005). The role of corticotropin-releasing factor-like peptides in cannabis, nicotine, and alcohol dependence: Brain Research Reviews Vol 49(3) Nov 2005, 505-528.
  • Bruijnzeel, A. W., Stam, R., Compaan, J. C., & Wiegant, V. M. (2001). Stress-induced sensitization of CRH-ir but not P-CREB-ir responsivity in the rat central nervous system: Brain Research Vol 908(2) Jul 2001, 187-196.
  • Bruijnzeel, A. W., Stam, R., & Wiegant, V. M. (2001). Effect of a benzodiazepine receptor agonist and corticotropin-releasing hormone receptor antagonists on long-term foot-shock-induced increase in defensive withdrawal behavior: Psychopharmacology Vol 158(2) Nov 2001, 132-139.
  • Bruijnzeel, A. W., Zislis, G., Wilson, C., & Gold, M. S. (2007). Antagonism of CRF receptors prevents the deficit in brain reward function associated with precipitated nicotine withdrawal in rats: Neuropsychopharmacology Vol 32(4) Apr 2007, 955-963.
  • Brunner, J., Stalla, G. K., Stalla, J., Uhr, M., Grabner, A., Wetter, T. C., et al. (2001). Decreased corticotropin-releasing hormone (CRH) concentrations in the cerebrospinal fluid of eucortisolemic suicide attempters: Journal of Psychiatric Research Vol 35(1) Jan-Feb 2001, 1-9.
  • Brunson, K. L., Avishai-Eliner, S., Hatalski, C. G., & Baram, T. Z. (2001). Neurobiology of the stress response early in life: Evolution of a concept and the role of corticotropin releasing hormone: Molecular Psychiatry Vol 6(6) Nov 2001, 647-656.
  • Bugajski, J., Borycz, J., Glod, R., & Bugajski, A. J. (1995). Crowding stress impairs the pituitary-adrenocortical responsiveness to the vasopressin but not corticotropin-releasing hormone stimulation: Brain Research Vol 681(1-2) May 1995, 223-228.
  • Bugajski, J., Olowska, A., Gadek-Michalska, A., & Borycz, J. (1995). Effect of indomethacin on the CRH and VP-induced pituitary-adrenocortical response during social stress: Life Sciences Vol 58(5) Dec 1995, PL67-PL72.
  • Bush, D. E. A. (2004). Corticotropin-releasing factor mediates the suppressing but not the facilitating effects of footshock on progressive-ratio cocaine self-administration. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Buwalda, B., de Boer, S. F., Van Kalkeren, A. A., & Koolhaas, J. M. (1997). Physiological and behavioral effects of chronic intracerebroventricular infusion of corticotropin-releasing factor in the rat: Psychoneuroendocrinology Vol 22(5) Jul 1997, 297-309.
  • Buwalda, B., Van Kalkeren, A. A., de Boer, S. F., & Koolhaas, J. M. (1998). Behavioral and physiological consequences of repeated daily intracerebroventricular injection of corticotropin-releasing factor in the rat: Psychoneuroendocrinology Vol 23(3) Apr 1998, 205-218.
  • Cabanac, M., & Richard, D. (1995). Acute intraventricular CRF lowers the hoarding threshold in male rats: Physiology & Behavior Vol 57(4) Apr 1995, 705-710.
  • Caberlotto, L., Rimondini, R., Hansson, A., Eriksson, S., & Heilig, M. (2004). Corticotropin-releasing hormone (CRH) mRNA expression in rat central amygdala in cannabinoid tolerance and withdrawal: Evidence for an allostatic shift? : Neuropsychopharmacology Vol 29(1) Jan 2004, 15-22.
  • Campbell, B. M., Morrison, J. L., Walker, E. L., & Merchant, K. M. (2004). Differential regulation of behavioral, genomic and neuroendocrine responses by CRF infusions in rats: Pharmacology, Biochemistry and Behavior Vol 77(3) Feb 2004, 447-455.
  • Carvalho-Netto, E. F., Litvin, Y., Nunes-de-Souza, R. L., Blanchard, D. C., & Blanchard, R. J. (2007). Effects of intra-PAG infusion of ovine CRF on defensive behaviors in Swiss-Webster mice: Behavioural Brain Research Vol 176(2) Jan 2007, 222-229.
  • Catalan, R., Gallart, J. M., Castellanos, J. M., & Galard, R. (1998). Plasma corticotropin-releasing factor in depressive disorders: Biological Psychiatry Vol 44(1) Jul 1998, 15-20.
  • Cates, P. S., Li, X. F., & O'Byrne, K. T. (2004). The influence of 17beta -oestradiol on corticotrophin-releasing hormone induced suppression of luteinising hormone pulses and the role of CRH in hypoglycemic stress-induced suppression of pulsatile LH secretion in the female rat: Stress: The International Journal on the Biology of Stress Vol 7(2) Jun 2004, 113-118.
  • Chang, C. L., & Hsu, S. Y. T. (2004). Ancient evolution of stress-regulating peptides in vertebrates: Peptides Vol 25(10) Oct 2004, 1681-1688.
  • Chang, F.-C., & Opp, M. R. (1999). Pituitary CR receptor blockade reduces waking in the rat: Physiology & Behavior Vol 67(5) Nov 1999, 691-696.
  • Chang, F.-C., & Opp, M. R. (2001). Corticotropin-releasing hormone (CRH) as a regulator of waking: Neuroscience & Biobehavioral Reviews Vol 25(5) Jul 2001, 445-453.
  • Chappell, P., Leckman, J., Goodman, W., Bissette, G., & et al. (1996). Elevated cerebrospinal fluid corticotropin-releasing factor in Tourette's syndrome: Comparison to obsessive compulsive disorder and normal controls: Biological Psychiatry Vol 39(9) May 1996, 776-783.
  • Chen, A., Zorrilla, E., Smith, S., Rousso, D., Levy, C., Vaughan, J., et al. (2006). Urocortin 2-Deficient Mice Exhibit Gender-Specific Alterations in Circadian Hypothalamus-Pituitary-Adrenal Axis and Depressive-Like Behavior: Journal of Neuroscience Vol 26(20) May 2006, 5500-5510.
  • Chen, A. M., Perrin, M. H., DiGruccio, M. R., Vaughan, J. M., Brar, B. K., Arias, C. M., et al. (2005). A soluble mouse brain splice variant of type 2alpha corticotropin-releasing factor (CRF) receptor binds ligands and modulates their activity: PNAS Proceedings of the National Academy of Sciences of the United States of America Vol 102(7) Feb 2005, 2620-2625.
  • Chen, Y., Bender, R. A., Frotscher, M., & Baram, T. Z. (2001). Novel and transient populations of corticotropin-releasing hormone-expressing neurons in developing hippocampus suggest unique functional roles: A quantitative spatiotemporal analysis: Journal of Neuroscience Vol 21(18) Sep 2001, 7171-7181.
  • Choi, D. C., Nguyen, M. M. N., Tamashiro, K. L. K., Ma, L. Y., Sakai, R. R., & Herman, J. P. (2006). Chronic social stress in the visible burrow system modulates stress-related gene expression in the bed nucleus of the stria terminalis: Physiology & Behavior Vol 89(3) Oct 2006, 301-310.
  • Choi, S., Blake, V., Cole, S., & Fernstrom, J. D. (2006). Effects of chronic fenfluramine administration on hypothalamic neuropeptide mRNA expression: Brain Research Vol 1087(1) May 2006, 83-86.
  • Choy, M. Y., Leung, T. N., & Lau, T. K. (2004). Corticotropin-releasing hormone peptide and human first-trimester placental growth: Early Human Development Vol 79(1) Aug 2004, 77-80.
  • Chu, K., Koob, G. F., Cole, M., Zorrilla, E. P., & Roberts, A. J. (2007). Dependence-induced increases in ethanol self-administration in mice are blocked by the CRF-sub-1 receptor antagonist antalarmin and by CRF-sub-1 receptor knockout: Pharmacology, Biochemistry and Behavior Vol 86(4) Apr 2007, 813-821.
  • Ciccocioppo, R., Biondini, M., Antonelli, L., Wichmann, J., Jenck, F., & Massi, M. (2002). Reversal of stress- and CRF-induced anorexia in rats by the synthetic nociceptin/orphanin FQ receptor agonist, Ro 64-6198: Psychopharmacology Vol 161(2) May 2002, 113-119.
  • Ciccocioppo, R., Cippitelli, A., Economidou, D., Fedeli, A., & Massi, M. (2004). Nociceptin/orphanin FQ acts as a functional antagonist of corticotropin-releasing factor to inhibit its anorectic effect: Physiology & Behavior Vol 82(1) Aug 2004, 63-68.
  • Ciccocioppo, R., Fedeli, A., Economidou, D., Policani, F., Weiss, F., & Massi, M. (2003). The Bed Nucleus Is a Neuroanatomical Substrate for the Anorectic Effect of Corticotropin-Releasing Factor and for Its Reversal by Nociceptin/Orphanin FQ: Journal of Neuroscience Vol 23(28) Oct 2003, 9445-9451.
  • Ciccocioppo, R., Martin-Fardon, R., Weiss, F., & Massi, M. (2001). Nociceptin/orphanin FQ inhibits stress- and CRF-induced anorexia in rats: Neuroreport: For Rapid Communication of Neuroscience Research Vol 12(6) May 2001, 1145-1149.
  • Claes, S., Villafuerte, S., Forsgren, T., Sluijs, S., Del-Favero, J., Adolfsson, R., et al. (2003). The Corticotropin-Releasing Hormone Binding Protein Is Associated with Major Depression in a Population from Northern Sweden: Biological Psychiatry Vol 54(9) Nov 2003, 867-872.
  • Claes, S. J. (2004). Corticotropin-releasing hormone (CRH) in psychiatry: From stress to psychopathology: Annals of Medicine Vol 36(1) Feb 2004, 50-61.
  • Claes, S. J., & Nemeroff, C. B. (2005). Corticotropin releasing factor (CRF) and major depression: Towards an integration of psychology and neurobiology in depression research. Leuven, Belgium; Mahwah, NJ: Leuven University Press; Lawrence Erlbaum Associates Publishers.
  • Cleare, A. J., O'Keane, V., & Miell, J. P. (2004). Levels of DHEA and DHEAS and responses to CRH stimulation and hydrocortisone treatment in chronic fatigue syndrome: Psychoneuroendocrinology Vol 29(6) Aug 2004, 724-732.
  • Clements, S., Moore, F. L., & Schreck, C. B. (2003). Evidence that acute serotonergic activation potentiates the locomotor-stimulating effects of corticotropin-releasing hormone in juvenile chinook salmon ( Oncorhynchus tshawytscha ): Hormones and Behavior Vol 43(1) Jan 2003, 214-221.
  • Cole, B. J., & Koob, G. F. (1994). Corticotropin-releasing factor and schedule-induced polydipsia: Pharmacology, Biochemistry and Behavior Vol 47(3) Mar 1994, 393-398.
  • Combi, R., Dalpra, L., Ferini-Strambi, L., & Tenchini, M. L. (2005). Frontal Lobe Epilepsy and Mutations of the Corticotropin-Releasing Hormone Gene: Annals of Neurology Vol 58(6) Dec 2005, 899-904.
  • Connan, F., Lightman, S. L., Landau, S., Wheeler, M., Treasure, J., & Campbell, I. C. (2007). An investigation of hypothalamic-pituitary-adrenal axis hyperactivity in anorexia nervosa: The role of CRH and AVP: Journal of Psychiatric Research Vol 41(1-2) Jan-Feb 2007, 131-143.
  • Contarino, A., Dellu, F., Koob, G. F., Smith, G. W., Lee, K.-F., Vale, W., et al. (1999). Reduced anxiety-like and cognitive performance in mice lacking the corticotropin-releasing factor receptor 1: Brain Research Vol 835(1) Jul 1999, 1-9.
  • Conti, L. H., Berridge, C. W., & Tayler, J. E. (2006). Both corticotropin-releasing factor and apomorphine reduce prepulse inhibition following repeated central infusion of corticotropin-releasing factor: Pharmacology, Biochemistry and Behavior Vol 85(1) Sep 2006, 261-272.
  • Conti, L. H., Costello, D. G., Martin, L. A., White, M. F., & et al. (1994). Mouse strain differences in the behavioral effects of corticotropin-releasing factor (CRF) and the CRF antagonist !a-helical CRF-sub(9-41): Pharmacology, Biochemistry and Behavior Vol 48(2) Jun 1994, 497-503.
  • Conti, L. H., Costill, J. E., Flynn, S., & Tayler, J. E. (2005). Effects of a Typical and an Atypical Antipsychotic on the Disruption of Prepulse Inhibition Caused by Corticotropin-Releasing Factor and by Rat Strain: Behavioral Neuroscience Vol 119(4) Aug 2005, 1052-1060.
  • Conti, L. H., & Foote, S. L. (1996). Reciprocal cross-desensitization of locus coeruleus electrophysiological responsivity to corticotropin-releasing factor and stress: Brain Research Vol 722(1-2) May 1996, 19-29.
  • Conti, L. H., Murry, J. D., Ruiz, M. A., & Printz, M. P. (2002). Effects of corticotropin-releasing factor on prepulse inhibition of the acoustic startle response in two rat strains: Psychopharmacology Vol 161(3) May 2002, 296-303.
  • Contoreggi, C., Herning, R. I., Na, P., Gold, P. W., Chrousos, G., Negro, P. J., et al. (2003). Stress Hormone Responses to Corticotropin-Releasing Hormone in Substance Abusers without Severe Comorbid Psychiatric Disease: Biological Psychiatry Vol 54(9) Nov 2003, 873-878.
  • Cook, C. J. (2002). Glucocorticoid feedback increases the sensitivity of the limbic system to stress: Physiology & Behavior Vol 75(4) Apr 2002, 455-464.
  • Cook, C. J. (2004). Stress induces CRF release in the paraventricular nucleus, and both CRF and GABA release in the amygdala: Physiology & Behavior Vol 82(4) Sep 2004, 751-762.
  • Cooper, M. A., & Huhman, K. L. (2005). Corticotropin-Releasing Factor Type II (CRF-sub-2) Receptors in the Bed Nucleus of the Stria Terminalis Modulate Conditioned Defeat in Syrian Hamsters (Mesocricetus auratus): Behavioral Neuroscience Vol 119(4) Aug 2005, 1042-1051.
  • Cooper, M. A., & Huhman, K. L. (2007). Corticotropin-releasing factor receptors in the dorsal raphe nucleus modulate social behavior in Syrian hamsters: Psychopharmacology Vol 194(3) Oct 2007, 297-307.
  • Coplan, J. D., Altemus, M., Mathew, S. J., Smith, E. L. P., Scharf, B., Coplan, P. M., et al. (2005). Synchronized Maternal-Infant Elevations of Primate CSF CRF Concentrations in Response to Variable Foraging Demand: CNS Spectrums Vol 10(7) Jul 2005, 530-536.
  • Coplan, J. D., Smith, E. L. P., Trost, R. C., Scharf, B. A., Altemus, M., Bjornson, L., et al. (2000). Growth hormone response to clonidine in adversely reared young adult primates: Relationship to serial cerebrospinal fluid corticotropin-releasing factor concentrations: Psychiatry Research Vol 95(2) Aug 2000, 93-102.
  • Cordner, A. P., Herwood, M. B., Helmreich, D. L., & Parfitt, D. B. (2004). Antidepressants Blunt the Effects of Inescapable Stress on Male Mating Behaviour and Decrease Corticotropin-Releasing Hormone mRNA Expression in the Hypothalamic Paraventricular Nucleus of the Syrian Hamster (Mesocricetus auratus): Journal of Neuroendocrinology Vol 16(7) Jul 2004, 628-636.
  • Costa, A., Nappi, R. E., Smeraldi, A., Bergamaschi, M., Navarra, P., & Grossman, A. (2001). Novel regulators of the in vitro release of hypothalamic corticotrophin-releasing hormone two decades after its discovery: A review: Functional Neurology Vol 16(Suppl4) 2001, 205-216.
  • Coste, S. C., Heard, A. D., Phillips, T. J., & Stenzel-Poore, M. P. (2006). Corticotropin-releasing factor receptor type 2-deficient mice display impaired coping behaviors during stress: Genes, Brain & Behavior Vol 5(2) Mar 2006, 131-138.
  • Coste, S. C., Murray, S. E., & Stenzel-Poore, M. P. (2001). Animal models of CRH excess and CRH receptor deficiency display altered adaptation to stress: Peptides Vol 22(5) May 2001, 733-741.
  • Courtney DeVries, A., Guptaa, T., Cardillo, S., Cho, M., & Carter, C. S. (2002). Corticotropin-releasing factor induces social preferences in male prairie voles: Psychoneuroendocrinology Vol 27(6) Aug 2002, 705-714.
  • Cratty, M. S., & Birkle, D. L. (1999). N-methyl-{d}-aspartate (NMDA)-mediated corticotropin-releasing factor (CRF) release in cultured rat amygdala neurons: Peptides Vol 20(1) 1999, 93-100.
  • Cratty, M. S., Ward, H. E., Johnson, E. A., Azzaro, A. J., & et al. (1995). Prenatal stress increases corticotropin-releasing factor (CRF) content and release in rat amygdala minces: Brain Research Vol 675(1-2) Mar 1995, 297-302.
  • Crespo, J. A., Manzanares, J., Oliva, J. M., Corchero, J., Garcia-Lecumberri, C., & Ambrosio, E. (2003). Extinction of cocaine self-administration produces alterations in corticotropin releasing factor gene expression in the paraventricular nucleus of the hypothalamus: Molecular Brain Research Vol 117(2) Oct 2003, 160-167.
  • Curtis, A. L., Pavcovich, L. A., & Valentino, R. J. (1999). Long-term regulation of locus ceruleus sensitivity to corticotropin-releasing factor by swim stress: Journal of Pharmacology and Experimental Therapeutics Vol 289(3) Jun 1999, 1211-1219.
  • Curtis, A. L., & Valentino, R. J. (1994). Corticotropin-releasing factor neurotransmission in locus coeruleus: A possible site of antidepressant action: Brain Research Bulletin Vol 35(5-6) 1994, 581-587.
  • Curtis, G. C., Abelson, J. L., & Gold, P. W. (1997). Adrenocorticotropic hormone and cortisol responses to corticotropin-releasing hormone: Changes in panic disorder and effects of alprazolam treatment: Biological Psychiatry Vol 41(1) Jan 1997, 76-85.
  • Da Costa, A. P. C., Kampa, R. J., Windle, R. J., Ingram, C. D., & Lightman, S. L. (1997). Region-specific immediate-early gene expression following the administration of corticotropin-releasing hormone in virgin and lactating rats: Brain Research Vol 770(1-2) Oct 1997, 151-162.
  • Dagnault, A., Ouerghi, D., & Richard, D. (1993). Treatment with !a-helical-CRF-sub((9-41) ) prevents the anorectic effect of 17-!b-estradiol: Brain Research Bulletin Vol 32(6) 1993, 689-692.
  • Dallman, M. F., Pecoraro, N. C., & la Fleur, S. E. (2005). Chronic stress and comfort foods: Self-medication and abdominal obesity: Brain, Behavior, and Immunity Vol 19(4) Jul 2005, 275-280.
  • Daniels, D., Markison, S., Grill, H. J., & Kaplan, J. M. (2004). Central Structures Necessary and Sufficient for Ingestive and Glycemic Responses to Urocortin I Administration: Journal of Neuroscience Vol 24(50) Dec 2004, 11457-11462.
  • D'Anna, K. L., Stevenson, S. A., & Gammie, S. C. (2005). Urocortin 1 and 3 Impair Maternal Defense Behavior in Mice: Behavioral Neuroscience Vol 119(4) Aug 2005, 1061-1071.
  • Dautzenberg, F. M., Kilpatrick, G. J., Hauger, R. L., & Moreau, J.-L. (2001). Molecular biology of the CRH receptors--In the mood: Peptides Vol 22(5) May 2001, 753-760.
  • Davis, K. L., Mohs, R. C., Marin, D. B., Purohit, D. P., Perl, D. P., Lantz, M., et al. (1999). Neuropeptide abnormalities in patients with early Alzheimer disease: Archives of General Psychiatry Vol 56(11) Nov 1999, 981-987.
  • de Jongh, R., Groenink, L., Gugten, J. v. d., & Olivier, B. (2003). Light-Enhanced and Fear-Potentiated Startle: Temporal Characteristics and Effects of alpha -Helical Corticotropin-Releasing Hormone: Biological Psychiatry Vol 54(10) Nov 2003, 1041-1048.
  • De Luca, V., Tharmalingam, S., & Kennedy, J. L. (2007). Association study between the corticotropin-releasing hormone receptor 2 gene and suicidality in bipolar disorder: European Psychiatry Vol 22(5) Jul 2007, 282-287.
  • de Pedro, N., Alonso-Gomez, A. L., Gancedo, B., Valenciano, A. I., Delgado, M. J., & Alonso-Bedate, M. (1997). Effect of alpha -helical-CRF-sub([9-41] ) on feeding in goldfish: Involvement of cortisol and catecholamines: Behavioral Neuroscience Vol 111(2) Apr 1997, 398-403.
  • de Pedro, N., Gancedo, B., Alonso-Gomez, A. L., Delgado, M. J., & et al. (1995). CRF effect on thyroid function is not mediated by feeding behavior in goldfish: Pharmacology, Biochemistry and Behavior Vol 51(4) Aug 1995, 885-890.
  • De Souza, E. B. (1995). Corticotropin-releasing factor receptors: Physiology, pharmacology, biochemistry and role in central nervous system and immune disorders: Psychoneuroendocrinology Vol 20(8) 1995, 789-819.
  • del C. Gonzalez, M. M., & Valatx, J. L. (1998). Involvement of stress in the sleep rebound mechanism induced by sleep deprivation in the rat: Use of alpha-helical CRH (9-41): Behavioural Pharmacology Vol 9(8) Dec 1998, 655-662.
  • Denbow, D. M., Snapir, N., & Furuse, M. (1999). Inhibition of food intake by CRF in chickens: Physiology & Behavior Vol 66(4) Jun 1999, 645-649.
  • Denver, R. J. (1997). Environmental stress as a developmental cue: Corticotropin-releasing hormone as a proximate mediator of adaptive phenotypic plasticity in amphibian metamorphosis: Hormones and Behavior Vol 31(2) Apr 1997, 169-179.
  • Denver, R. J. (1997). "Environmental stress as a developmental cue: Corticotropin-releasing hormone is a proximate mediator of adaptive phenotypic plasticity in amphibian metamorphes": Errata: Hormones and Behavior Vol 32(1) Aug 1997, 68.
  • Deuschle, M., Schweiger, U., Gotthardt, U., Weber, B., Korner, A., Schmider, J., et al. (1998). The combined dexamethasone/corticotropin-releasing hormone stimulation test is more closely associated with features of diurnal activity of the hypothalamo-pituitary-adrenocortical system than the dexamethasone suppression test: Biological Psychiatry Vol 43(10) May 1998, 762-766.
  • DeVries, A. C., & Pert, A. (1998). Conditioned increases in anxiogenic-like behavior following exposure to contextual stimuli associated with cocaine are mediated by corticotropin-releasing factor: Psychopharmacology Vol 137(4) Jun 1998, 333-340.
  • DeVries, A. C., Taymans, S. E., Sundstrom, J. M., & Pert, A. (1998). Conditioned release of corticosterone by contextual stimuli associated with cocaine is mediated by corticotropin-releasing factor: Brain Research Vol 786(1-2) Mar 1998, 39-46.
  • Dirks, A., Fish, E. W., Kikusui, T., van der Gugten, J., Groenink, L., Olivier, B., et al. (2002). Effects of corticotropin-releasing hormone on distress vocalizations and locomotion in maternally separated mouse pups: Pharmacology, Biochemistry and Behavior Vol 72(4) Jul 2002, 993-999.
  • Dirks, A., Groenink, L., Schipholt, M. I., van der Gugten, J., Hijzen, T. H., Geyer, M. A., et al. (2002). Reduced startle reactivity and plasticity in transgenic mice overexpressing corticotropin-releasing hormone: Biological Psychiatry Vol 51(7) Apr 2002, 583-590.
  • Dirks, A., Groenink, L., Verdouw, P. M., Schipholt, M. L., Van Der Gugten, J., Hijzen, T. H., et al. (2001). Behavioral analysis of transgenic mice overexpressing corticotropin-releasing hormone in paradigms emulating aspects of stress, anxiety, and depression: International Journal of Comparative Psychology Vol 14(3-4) 2001, 123-135.
  • Dirks, A., Groenink, L., Westphal, K. G. C., Olivier, J. D. A., Verdouw, P. M., van der Gugten, J., et al. (2003). Reversal of Startle Gating Deficits in Transgenic Mice Overexpressing Corticotropin-Releasing Factor by Antipsychotic Drugs: Neuropsychopharmacology Vol 28(10) Oct 2003, 1790-1798.
  • Djouma, E., Card, K., Lodge, D. J., & Lawrence, A. J. (2006). The CRF-sub-1 receptor antagonist, antalarmin, reverses isolation-induced up-regulation of dopamine D-sub-2 receptors in the amygdala and nucleus accumbens of fawn-hooded rats: European Journal of Neuroscience Vol 23(12) Jun 2006, 3319-3327.
  • Dmitrieva, T. N., Oades, R. D., Hauffa, B. P., & Eggers, C. (2001). Dehydroepiandrosterone sulphate and corticotropin levels are high in young male patients with conduct disorder: Comparisons for growth factors, thyroid and gonadal hormones: Neuropsychobiology Vol 43(3) 2001, 134-140.
  • Dorn, L. D., Burgess, E. S., Susman, E. J., von Eye, A., & et al. (1996). Response to oCRH in depressed and nondepressed adolescents: Does gender make a difference? : Journal of the American Academy of Child & Adolescent Psychiatry Vol 35(6) Jun 1996, 764-773.
  • Ducottet, C., Griebel, G., & Belzung, C. (2003). Effects of the selective nonpeptide corticotropin-releasing factor receptor 1 antagonist antalarmin in the chronic mild stress model of depression in mice: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 27(4) Jun 2003, 625-631.
  • Duncko, R., Kiss, A., Skultetyova, I., Rusnak, M., & Jezova, D. (2001). Corticotropin-releasing hormone mRNA levels in response to chronic mild stress rise in male but not in female rats while tyrosine hydroxylase mRNA levels decrease in both sexes: Psychoneuroendocrinology Vol 26(1) Jan 2001, 77-89.
  • Dunn, A. J. (2000). Footshock-induced changes in brain catecholamines and indoleamines are not mediated by CRF or ACTH: Neurochemistry International Vol 37(1) Jul 2000, 61-69.
  • Dunn, A. J., & Swiergiel, A. H. (1999). Behavioral responses to stress are intact in CRF-deficient mice: Brain Research Vol 845(1) Oct 1999, 14-20.
  • Dzung Le, A., Funk, D., Harding, S., Juzytsch, W., Li, Z., & Fletcher, P. J. (2008). "Intra-median raphe nucleus (MRN) infusions of muscimol, a GABA-A receptor agonist, reinstate alcohol seeking in rats: Role of impulsivity and reward": Erratum: Psychopharmacology Vol 195(4) Jan 2008, 617.
  • Edwards, C. M. B., Abbott, C. R., Sunter, D., Kim, M.-S., Dakin, C. L., Murphy, K. G., et al. (2000). Cocaine- and amphetamine-regulated transcript, glucagon-like peptide-1 and corticotropin releasing factor inhibit feeding via agouti-related protein independent pathways in the rat: Brain Research Vol 866(1-2) Jun 2000, 128-134.
  • Eggers, V., Pascher, A., Althoff, H., Thiele, S., Mutze, J., Selignow, J., et al. (2006). Immune Reactivity is More Suppressed in Patients with Alcoholic Liver Disease than in Patients with Virus-Induced Cirrhosis after CRH Stimulation: Alcoholism: Clinical and Experimental Research Vol 30(1) Jan 2006, 140-149.
  • Eghbal-Ahmadi, M., Avishai-Eliner, S., Hatalski, C. G., & Baram, T. Z. (1999). Differential regulation of the expression of corticotropin-releasing factor receptor type 2 (CRF-sub-2) in hypothalamus and amygdala of the immature rat by sensory input and food intake: Journal of Neuroscience Vol 19(10) May 1999, 3982-3991.
  • Ehnvall, A., Sjogren, M., Zachrisson, O. C., & Agren, H. (2004). HPA axis activation determined by the CRN challenge test in patients with few versus multiple episodes of treatment-refractory depression: European Archives of Psychiatry and Clinical Neuroscience Vol 254(6) 2004, 349-355.
  • Ehrenreich, H., tom Dieck, K., Gefeller, O., Kaw, S., & et al. (1997). Sustained elevation of vasopressin plasma levels in healthy young men, but not in abstinent alcoholics, upon expectation of novelty: Psychoneuroendocrinology Vol 22(1) Jan 1997, 13-24.
  • Elenkov, I. J., Webster, E. L., Torpy, D. J., & Chrousos, G. P. (1999). Stress, corticotropin-releasing hormone, glucocorticoids, and the immune/inflammatory response: Acute and chronic effects. New York, NY: New York Academy of Sciences.
  • Emoto, H., Koga, C., Ishii, H., Yokoo, H., & et al. (1993). A CRF antagonist attenuates stress-induced increases in NA turnover in extended brain regions in rats: Brain Research Vol 627(1) Nov 1993, 171-176.
  • Erb, S., & Brown, Z. J. (2006). A role for corticotropin-releasing factor in the long-term expression of behavioral sensitization to cocaine: Behavioural Brain Research Vol 172(2) Jul 2006, 360-364.
  • Erb, S., Funk, D., & Le, A. D. (2003). Prior, repeated exposure to cocaine potentiates locomotor responsivity to central injections of corticotropin-releasing factor (CRF) in rats: Psychopharmacology Vol 170(4) Dec 2003, 383-389.
  • Erb, S., Kayyali, H., & Romero, K. (2006). A study of the lasting effects of cocaine pre-exposure on anxiety-like behaviors under baseline conditions and in response to central injections of corticotropin-releasing factor: Pharmacology, Biochemistry and Behavior Vol 85(1) Sep 2006, 206-213.
  • Erb, S., Petrovic, A., Yi, D., & Kayyali, H. (2006). Central injections of CRF reinstate cocaine seeking in rats after postinjection delays of up to 3 h: an influence of time and environmental context: Psychopharmacology Vol 187(1) Jul 2006, 112-120.
  • Erb, S., Salmaso, N., Rodaros, D., & Stewart, J. (2001). A role for the CRF-containing pathway from central nucleus of the amygdala to bed nucleus of the stria terminalis in the stress-induced reinstatement of cocaine seeking in rats: Psychopharmacology Vol 158(4) Dec 2001, 360-365.
  • Erb, S., Shaham, Y., & Stewart, J. (1998). The role of corticotropin-releasing factor and corticosterone in stress- and cocaine-induced relapse to cocaine seeking in rats: Journal of Neuroscience Vol 18(14) Jul 1998, 5529-5536.
  • Erb, S. M. (2000). Stress-induced relapse to cocaine seeking in the rat: Contributions of central nervous system corticotropin-releasing factor and noradrenaline. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Esposito, P., Basu, S., Letourneau, R., Jacobson, S., & Theoharides, T. C. (2003). Corticotropic-releasing factor (CRF) can directly affect brain micovessal endothelial cells: Brain Research Vol 968(2) Apr 2003, 192-198.
  • Esposito, P., Chandler, N., Kandere, K., Basu, S., Jacobson, S., Connolly, R., et al. (2002). Corticotropin-releasing hormone and brain mast cells regulate blood-brain-barrier permeability induced by acute stress: Journal of Pharmacology and Experimental Therapeutics Vol 303(3) Dec 2002, 1061-1066.
  • Fabricio, A. S. C., Tringali, G., Pozzoli, G., & Navarra, P. (2005). Mirtazapine acutely inhibits basal and K-super(+)-stimulated release of corticotropin-releasing hormone from the rat hypothalamus via a non-genomic mechanism: Psychopharmacology Vol 178(1) Feb 2005, 78-82.
  • Facci, L., Stevens, D. A., Pangallo, M., Franceschini, D., Skaper, S. D., & Strijbos, P. J. L. M. (2003). Corticotropin-releasing factor (CRF) and related peptides confer neuroprotection via type 1 CRF receptors: Neuropharmacology Vol 45(5) Oct 2003, 623-636.
  • Farrokhi, C., Blanchard, D. C., Griebel, G., Yang, M., Gonzales, C., Markham, C., et al. (2004). Effects of the CRF1 antagonist SSR125543A on aggressive behaviors in hamsters: Pharmacology, Biochemistry and Behavior Vol 77(3) Feb 2004, 465-469.
  • Faruzzi, A. N. (2006). Corticotropin releasing factor receptors and agonistic behavior in Syrian hamsters. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Feldman, S., Conforti, N., Itzik, A., & Weidenfeld, J. (1994). Differential effect of amygdaloid lesions on CRF-41, ACTH and corticosterone responses following neural stimuli: Brain Research Vol 658(1-2) Sep 1994, 21-26.
  • Feldman, S., Conforti, N., & Weidenfeld, J. (1995). Limbic pathways and hypothalamic neurotransmitters mediating adrenocortical responses to neural stimuli: Neuroscience & Biobehavioral Reviews Vol 19(2) Sum 1995, 235-240.
  • Feldman, S., & Weidenfeld, J. (1993). Hypothalamic norepinephrine depletion inhibits CRF-41 release following neural stimuli: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 5(3) Dec 1993, 258-260.
  • Fenoglio, K. A., Chen, Y., & Baram, T. Z. (2006). Neuroplasticity of the Hypothalamic-Pituitary-Adrenal Axis Early in Life Requires Recurrent Recruitment of Stress-Regulating Brain Regions: Journal of Neuroscience Vol 26(9) Mar 2006, 2434-2442.
  • Flint, M. S., Morgan, J. B., Shreve, S. N., & Tinkle, S. S. (2003). Restraint stress and corticotropin releasing hormone modulation of murine cutaneous POMC mRNA: Stress: The International Journal on the Biology of Stress Vol 6(1) Feb 2003, 59-62.
  • Forman, S. D., Bissette, G., Yao, J., Nemeroff, C. B., & et al. (1994). Cerebrospinal fluid corticotropin-releasing factor increases following haloperidol withdrawal in chronic schizophrenia: Schizophrenia Research Vol 12(1) Apr 1994, 43-51.
  • Fossey, M. D., Lydiard, R. B., Ballenger, J. C., Laraia, M. T., & et al. (1996). Cerebrospinal fluid corticotropin-releasing factor concentrations in patients with anxiety disorders and normal comparison subjects: Biological Psychiatry Vol 39(8) Apr 1996, 703-707.
  • Francis, D. D., Caldji, C., Champagne, F., Plotsky, P. M., & Meaney, M. J. (1999). The role of corticotropin-releasing factor-norepinephrine systems in mediating the effects of early experience on the development of behavioral and endocrine responses to stress: Biological Psychiatry Vol 46(9) Nov 1999, 1153-1166.
  • French, J. A., Fite, J. E., Jensen, H., Oparowski, K., Rukstalis, M. R., Fix, H., et al. (2007). Treatment with CRH-1 antagonist antalarmin reduces behavioral and endocrine responses to social stressors in marmosets (Callithrix kuhlii): American Journal of Primatology Vol 69(8) Aug 2007, 877-889.
  • Friedman, M. J. (2000). What might the psychobiology of posttraumatic stress disorder teach us about future approaches to pharmacotherapy? : Journal of Clinical Psychiatry Vol 61(Suppl7) 2000, 44-51.
  • Fuchs, E., & Flugge, G. (1995). Modulation of binding sites for corticotropin-releasing hormone by chronic psychosocial stress: Psychoneuroendocrinology Vol 20(1) 1995, 33-51.
  • Fulton, S., Richard, D., Woodside, B., & Shizgal, P. (2002). Interaction of CRH and energy balance in the modulation of brain stimulation reward: Behavioral Neuroscience Vol 116(4) Aug 2002, 651-659.
  • Funabashi, T., Kawaguchi, M., Furuta, M., Fukushima, A., & Kimura, F. (2004). Exposure to bisphenol A during gestation and lactation causes loss of sex difference in corticotropin-releasing hormone-immunoreactive neurons in the bed nucleus of the stria terminalis of rats: Psychoneuroendocrinology Vol 29(4) May 2004, 475-485.
  • Funk, C. K., & Koob, G. F. (2007). A CRF-sub-2 agonist administered into the central nucleus of the amygdala decreases ethanol self-administration in ethanol-dependent rats: Brain Research Vol 1155 Jun 2007, 172-178.
  • Gabr, R. W. (1994). Central regulation of corticotropin releasing factor release in the median eminence of rat brain: An in vivo microdialysis study. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Gabriel, K. I., Yu, C. L., Osborn, J. A., & Weinberg, J. (2006). Prenatal ethanol exposure alters sensitivity to the effects of corticotropin-releasing factor (CRF) on behavior in the elevated plus-maze: Psychoneuroendocrinology Vol 31(9) Oct 2006, 1046-1056.
  • Gabry, K. E., Chrousos, G. P., Rice, K. C., Mostafa, R. M., Sternberg, E., Negrao, A. B., et al. (2002). Marked suppression of gastric ulcerogenesis and intestinal responses to stress by a novel class of drugs: Molecular Psychiatry Vol 7(5) 2002, 474-483.
  • Gadient, S. D. P. (1996). The effects of bilateral adrenalectomy and colchicine on vasopressin and corticotropin-releasing factor immunoreactivity in the paraventricular nucleus of female Syrian hamsters. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Galard, R., Catalan, R., Castellanos, J. M., & Gallart, J. M. (2002). Plasma corticopin-releasing factor in depressed patients before and after the dexamethasone suppression test: Biological Psychiatry Vol 51(6) Mar 2002, 463-468.
  • Gammie, S. C., Hasen, N. S., Stevenson, S. A., Bale, T. L., & D'Anna, K. L. (2005). Elevated stress sensitivity in corticotropin-releasing factor receptor 2 deficient mice decreases maternal, but not intermale aggression: Behavioural Brain Research Vol 160(1) May 2005, 169-177.
  • Gammie, S. C., Negron, A., Newman, S. M., & Rhodes, J. S. (2004). Corticotropin-Releasing Factor Inhibits Maternal Aggression in Mice: Behavioral Neuroscience Vol 118(4) Aug 2004, 805-814.
  • Gammie, S. C., & Stevenson, S. A. (2006). Intermale aggression in corticotropin-releasing factor receptor 1 deficient mice: Behavioural Brain Research Vol 171(1) Jul 2006, 63-69.
  • Gannon, R. L., & Millan, M. J. (2006). The corticotropin-releasing factor (CRF)-sub-1 receptor antagonists CP154,526 and DMP695 inhibit light-induced phase advances of hamster circadian activity rhythms: Brain Research Vol 1083(1) Apr 2006, 96-102.
  • Garcia-Lecumberri, C., & Ambrosio, E. (2000). Differential effect of low doses of intracerebroventricular corticotropin-releasing factor in forced swimming test: Pharmacology, Biochemistry and Behavior Vol 67(3) Nov 2000, 519-525.
  • Gardi, J., Biro, E., Vecsernyes, M., Julesz, J., & et al. (1997). The effects of brain and C-type natriuretic peptides on corticotropin-releasing factor in brain of rats: Life Sciences Vol 60(23) May 1997, 2111-2117.
  • Gardner, J. D., Rothwell, N. J., & Luheshi, G. N. (1998). Leptin affects food intake via CRF-receptor-mediated pathways: Nature Neuroscience Vol 1(2) Jun 1998, 103.
  • Gehlert, D. R., Cippitelli, A., Thorsell, A., Le, A. D., Hipskind, P. A., Hamdouchi, C., et al. (2007). 3-(4-Chloro-2-morpholin-4-yl-Thiazol-5-yl)-8-(1-ethylpropyl)-2,6-dimethyl-imidazo[1,2-b]pyridazine: A novel brain-penetrant, orally available corticotropin- releasing factor receptor 1 antagonist with efficacy in animal models of alcoholism: Journal of Neuroscience Vol 27(10) Mar 2007, 2718-2726.
  • George, O., Ghozland, S., Azar, M. R., Cottone, P., Zorrilla, E. P., Parsons, L. H., et al. (2007). CRF-CRF-sub-1 system activation mediates withdrawal-induced increases in nicotine self-administration in nicotine-dependent rats: PNAS Proceedings of the National Academy of Sciences of the United States of America Vol 104(43) Oct 2007, 17198-17203.
  • Geracioti, T. D., Loosen, P. T., & Orth, D. N. (1997). Low cerebrospinal fluid corticotropin-releasing hormone concentrations in eucortisolemic depression: Biological Psychiatry Vol 42(3) Aug 1997, 165-174.
  • Gesing, A., Bilang-Bleuel, A., Droste, S. K., Linthorst, A. C. E., Holsboer, F., & Reul, J. M. H. M. (2001). Psychological stress increases hippocampal mineralocorticoid receptor levels: Involvement of corticotropin-releasing hormone: Journal of Neuroscience Vol 21(13) Jul 2001, 4822-4829.
  • Ghitza, U. E., Gray, S. M., Epstein, D. H., Rice, K. C., & Shaham, Y. (2006). The Anxiogenic Drug Yohimbine Reinstates Palatable Food Seeking in a Rat Relapse Model: A Role of CRF-sub-1 Receptors: Neuropsychopharmacology Vol 31(10) Oct 2006, 2188-2196.
  • Gilmor, M., Skelton, K. H., Nemeroff, C. B., & Owens, M. J. (2003). The effects of chronic treatment with the mood stabilizers valproic acid and lithium on corticotropin-releasing factor neuronal systems: Journal of Pharmacology and Experimental Therapeutics Vol 305(2) May 2003, 434-439.
  • Ginsberg, A. B., Campeau, S., Day, H. E., & Spencer, R. L. (2003). Acute Glucocorticoid Pretreatment Suppresses Stress-Induced Hypothalamic-Pituitary-Adrenal Axis Hormone Secretion and Expression of Corticotropin-Releasing Hormone hnRNA but Does Not Affect c-fos mRNA or Fos Protein Expression in the Paraventricular Nucleus of the Hypothalamus: Journal of Neuroendocrinology Vol 15(11) Nov 2003, 1075-1083.
  • Glynn, L. M., Wadhwa, P. D., & Sandman, C. A. (2000). The Influence of Corticotropin-Releasing Hormone on Human Fetal Development and Parturition: Journal of Prenatal & Perinatal Psychology & Health Vol 14(3-4) Spr-Sum 2000, 243-256.
  • Goeders, N. E., & Guerin, G. F. (2000). Effects of the CRH receptor antagonist CP-154,526 on intravenous cocaine self-administration in rats: Neuropsychopharmacology Vol 23(5) Nov 2000, 577-586.
  • Gold, P. W., & Chrousos, G. P. (2002). Organization of the stress system and its dysregulation in melancholic and atypical depression: High vs low CRH/NE states: Molecular Psychiatry Vol 7(3) 2002, 254-275.
  • Goliszek, A. G., Crawford, G. E., Lawrence, H. S., Bennett, J., & et al. (1996). Effects of prepubertal stress on subsequent ACTH response to novel stress and CRH in male vs female rats: Stress Medicine Vol 12(3) Jul 1996, 199-204.
  • Gorman, J. M. (2003). New molecular targets for antianxiety interventions: Journal of Clinical Psychiatry Vol 64(Suppl3) Mar 2003, 28-35.
  • Graham, E. S., Littlewood, P., Turnbull, Y., Mercer, J. G., Morgan, P. J., & Barrett, P. (2005). Short Communication: Neuromedin-U is regulated by the circadian clock in the SCN of the mouse: European Journal of Neuroscience Vol 21(3) Feb 2005, 814-819.
  • Graham, Y. P., Heim, C., Goodman, S. H., Miller, A. H., & Nemeroff, C. B. (1999). The effects of neonatal stress on brain development: Implications for psychopathology: Development and Psychopathology Vol 11(3) Sum 1999, 545-565.
  • Granger, D. A., Hood, K. E., Ikeda, S., Reed, C. L., & et al. (1996). Neonatal endotoxin exposure alters the development of social behavior and the hypothalamic-pituitary-adrenal axis in selectively bred mice: Brain, Behavior, and Immunity Vol 10(3) Sep 1996, 249-259.
  • Greisen, M. H., Bolwig, T. G., Husum, H., Nedergaard, P., & Wortwein, G. (2005). Maternal separation affects male rat copulatory behaviour and hypothalamic corticotropin releasing factor in concert: Behavioural Brain Research Vol 158(2) Mar 2005, 367-375.
  • Griebel, G., Perrault, G., & Sanger, D. J. (1998). Characterization of the behavioral profile of the non-peptide CRF receptor antagonist CP-154,526 in anxiety models in rodents: Comparison with diazepam and buspirone: Psychopharmacology Vol 138(1) Jul 1998, 55-66.
  • Griebel, G., Simiand, J., Steinberg, R., Jung, M., Gully, D., Roger, P., et al. (2002). 4-(2-Chloro-4-methoxy-5-methylphenyl)-N-[(1S)-2-cyclopropyl-1-(3-fluoro-4-methylphenyl)ethyl]5-methyl-N-(2-propynyl)-1, 3-thiazol-2-amine hydrochloride (SSR125543A), a potent and selective corticotrophin-releasing factor-sub-1 receptor antagonist.II.Characterization in rodent models of stress-related disorders: Journal of Pharmacology and Experimental Therapeutics Vol 301(1) Apr 2002, 333-345.
  • Grill, H. J., Markison, S., Ginsberg, A., & Kaplan, J. M. (2000). Long-term effects on feeding and body weight after stimulation of forebrain or hindbrain CRH receptors with urocortin: Brain Research Vol 867(1-2) Jun 2000, 19-28.
  • Groenink, L., Dirks, A., Verdouw, P. M., lutje Schipholt, M., Veening, J. G., van der Gugten, J., et al. (2002). HPA axis dysregulation in mice overexpressing corticotropin releasing hormone: Biological Psychiatry Vol 51(11) Jun 2002, 875-881.
  • Grossman, A., & Costa, A. (1993). The regulation of hypothalamic CRH: Impact of in vitro studies on the central control of the stress response: Functional Neurology Vol 8(5) Sep-Oct 1993, 325-334.
  • Gue, M., Tekamp, A., Tabis, N., Junien, J. L., & et al. (1994). Cholecystokinin blockade of emotional stress- and CRF-induced colonic motor alterations in rats: Role of the amygdala: Brain Research Vol 658(1-2) Sep 1994, 232-238.
  • Gutman, D. A., & Nemeroff, C. B. (2003). Persistent central nervous system effects of an adverse early environment: clinical and preclinical studies: Physiology & Behavior Vol 79(3) Aug 2003, 471-478.
  • Gutman, D. A., Owens, M. J., Skelton, K. H., Thrivikraman, K. V., & Nemeroff, C. B. (2003). The corticotropin-releasing factor-sub-1 receptor antagonist R121919 attenuates the behavioral and endocrine responses to stress: Journal of Pharmacology and Experimental Therapeutics Vol 304(2) Feb 2003, 874-880.
  • Gysling, K., Forray, M. I., Haeger, P., Daza, C., & Rojas, R. (2004). Corticotropin-releasing hormone and urocortin: Redundant or distinctive functions? : Brain Research Reviews Vol 47(1-3) Dec 2004, 116-125.
  • Haddy, R. I., & Clover, R. D. (2001). The biological processes in psychological stress: Families, Systems, & Health Vol 19(3) Fal 2001, 291-302.
  • Hammack, S. E. (2002). The role of corticotropin releasing hormone in learned helplessness. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Hammack, S. E., Richey, K. J., Schmid, M. J., LoPresti, M. L., Watkins, L. R., & Maier, S. F. (2002). The role of corticotropin-releasing hormone in the dorsal raphe nucleus in mediating the behavioral consequences of uncontrollable stress: Journal of Neuroscience Vol 22(3) Feb 2002, 1020-1026.
  • Hammack, S. E., Schmid, M. J., LoPresti, M. L., Der-Avakian, A., Pellymounter, M. A., Foster, A. C., et al. (2003). Corticotropin Releasing Hormone Type 2 Receptors in the Dorsal Raphe Nucleus Mediate the Behavioral Consequences of Uncontrollable Stress: Journal of Neuroscience Vol 23(3) Feb 2003, 1019-1025.
  • Hand, G. A., Hewitt, C. B., Fulk, L. J., Stock, H. S., Carson, J. A., Davis, J. M., et al. (2002). Differential release of corticotropin-releasing hormone (CRH) in the amygdala during different types of stressors: Brain Research Vol 949(1-2) Sep 2002, 122-130.
  • Harbuz, M. S., Jessop, D. S., Lightman, S. L., & Chowdrey, H. S. (1994). The effects of restraint or hypertonic saline stress on corticotropin-releasing factor, arginine vasopressin, and proenkephalin A mRNAs in the CFY, Sprague-Dawley and Wistar strains of rat: Brain Research Vol 667(1) Dec 1994, 6-12.
  • Harrigan, E. A., Magnuson, D. J., Thunstedt, G. M., & Gray, T. S. (1994). Corticotropin releasing factor neurons are innervated by calcitonin gene-related peptide terminals in the rat central amygdaloid nucleus: Brain Research Bulletin Vol 33(5) 1994, 529-534.
  • Harris, R. B. S., Zhou, J., Shi, M., Redmann, S., Mynatt, R. L., & Ryan, D. H. (2001). Overexpression of agouti protein and stress responsiveness in mice: Physiology & Behavior Vol 73(4) Jul 2001, 599-608.
  • Harte, J. L., Eifert, G. H., & Smith, R. (1995). The effects of running and meditation on beta-endorphin, corticotropin-releasing hormone and cortisol in plasma, and on mood: Biological Psychology Vol 40(3) Jun 1995, 251-265.
  • Hartmann, A., Krumrey, K., Vogl, L., & Dirlich, G. (1996). Changes in late auditory evoked potentials induced by corticotropin-releasing-hormone and corticotropin fragment 4-9 in male controls: Neuropsychobiology Vol 33(2) Mar 1996, 90-96.
  • Harvey, A. T., & Hennessy, M. B. (1995). Corticotropin-releasing factor modulation of the ultrasonic vocalization rate of isolated rat pups: Developmental Brain Research Vol 87(2) Jul 1995, 125-134.
  • Hatalski, C. G., Guirguis, C., & Baram, T. Z. (1998). Corticotropin Releasing Factor mRNA Expression in the Hypothalamic Paraventricular Nucleus and the Central Nucleus of the Amygdala is Modulated by Repeated Acute Stress in the Immature Rat: Journal of Neuroendocrinology Vol 10(9) Sep 1998, 663-669.
  • Hatzinger, M., Z'Brun, A., Hemmeter, U., Seifritz, E., & et al. (1995). Hypothalamic-pituitary-adrenal system function in patients with Alzheimer's disease: Neurobiology of Aging Vol 16(2) Mar-Apr 1995, 205-209.
  • Hauger, R. L., Olivares-Reyes, J. A., Braun, S., Catt, K. J., & Dautzenberg, F. M. (2003). Mediation of Corticotropin Releasing Factor Type 1 Receptor Phosphorylation and Desensitization by Protein Kinase C: A Possible Role in Stress Adaptation: Journal of Pharmacology and Experimental Therapeutics Vol 306(2) Aug 2003, 794-803.
  • Hayden-Hixson, D. M., & Nemeroff, C. B. (1993). Role(s) of neuropeptides in responding and adaptation to stress: A focus on corticotropin-releasing factor and opioid peptides. San Diego, CA: Academic Press.
  • Hayes, D. M., Knapp, D. J., Breese, G. R., & Thiele, T. E. (2005). Comparison of Basal Neuropeptide Y and Corticotropin Releasing Factor Levels Between the High Ethanol Drinking C57BL/6J and Low Ethanol Drinking DBA/2J Inbred Mouse Strains: Alcoholism: Clinical and Experimental Research Vol 29(5) May 2005, 721-729.
  • Heilig, M., & Ekman, R. (1995). Chronic parenteral antidepressant treatment in rats: Unaltered levels and processing of neuropeptide Y (NPY) and corticotropin-releasing hormone (CRH): Neurochemistry International Vol 26(4) Apr 1995, 351-355.
  • Heilig, M., & Koob, G. F. (2007). A key role for corticotropin-releasing factor in alcohol dependence: Trends in Neurosciences Vol 30(8) Aug 2007, 399-406.
  • Heim, C., & Nemeroff, C. B. (1999). The impact of early adverse experiences on brain systems involved in the pathophysiology of anxiety and affective disorders: Biological Psychiatry Vol 46(11) Dec 1999, 1509-1522.
  • Heim, C., Owens, M. J., Plotsky, P. M., & Nemeroff, C. B. (1997). Persistent changes in corticotropin-releasing factor systems due to early life stress: Relationship to the pathophysiology of major depression and post-traumatic stress disorder: Psychopharmacology Bulletin Vol 33(2) 1997, 185-192.
  • Heim, C., Owens, M. J., Plotsky, P. M., & Nemeroff, C. B. (1997). The role of early adverse life events in the etiology of depression and posttraumatic stress disorder. Focus on corticotropin-releasing factor. New York, NY: New York Academy of Sciences.
  • Heinrichs, S. C. (2003). Modulation of social learning in rats by brain corticotropin-releasing factor: Brain Research Vol 994(1) Dec 2003, 107-114.
  • Heinrichs, S. C., De Souza, E. B., Schulteis, G., Lapsansky, J. L., & Grigoriadis, D. E. (2002). Brain penetrance, receptor occupancy and antistress in vivo efficacy of a small molecule corticotropin releasing factor type I receptor selective antagonist: Neuropsychopharmacology Vol 27(2) Aug 2002, 194-202.
  • Heinrichs, S. C., & Joppa, M. (2001). Dissociation of arousal-like from anxiogenic-like actions of brain corticotropin-releasing factor receptor ligands in rats: Behavioural Brain Research Vol 122(1) 2001, 43-50.
  • Heinrichs, S. C., Klaassen, A., Koob, G. F., Schulteis, G., Ahmed, S., & De Souza, E. B. (1998). Corticotropin-releasing factor receptor blockade enhances conditioned aversive properties of cocaine in rats: Psychopharmacology Vol 136(3) Apr 1998, 247-255.
  • Heinrichs, S. C., & Koob, G. F. (2004). Corticotropin-Releasing Factor in Brain: A Role in Activation, Arousal, and Affect Regulation: Journal of Pharmacology and Experimental Therapeutics Vol 311(2) Nov 2004, 427-440.
  • Heinrichs, S. C., Li, D. L., & Iyengar, S. (2001). Corticotropin-releasing factor (CRF) and CRF binding-protein ligand inhibitor administration suppresses food intake in mice and elevates body temperature in rats: Brain Research Vol 900(2) May 2001, 177-185.
  • Heinrichs, S. C., Menzaghi, F., Pich, E. M., Baldwin, H. A., & et al. (1994). Anti-stress action of a Corticotropin-Releasing Factor antagonist on behavioral reactivity to stressors of varying type and intensity: Neuropsychopharmacology Vol 11(3) Nov 1994, 179-186.
  • Heinrichs, S. C., Menzaghi, F., Schulteis, G., Koob, G. F., & et al. (1995). Suppression of corticotropin-releasing factor in the amygdala attenuates aversive consequences of morphine withdrawal: Behavioural Pharmacology Vol 6(1) Jan 1995, 74-80.
  • Heinrichs, S. C., Min, H., Tamraz, S., Carmouche, M., & et al. (1997). Anti-sexual and anxiogenic behavioral consequences of corticotropin-releasing factor overexpression are centrally mediated: Psychoneuroendocrinology Vol 22(4) May 1997, 215-224.
  • Heinrichs, S. C., Vale, E. A., Lapsansky, J., Behan, D. P., McClure, L. V., Ling, N., et al. (1997). Enhancement of performance in multiple learning tasks by corticotropin-releasing factor-binding protein ligand inhibitors: Peptides Vol 18(5) 1997, 711-716.
  • Held, K., Kunzel, H., Ising, M., Schmid, D. A., Zobel, A., Murck, H., et al. (2004). Treatment with the CRH-sub-1-receptor-antagonist R121919 improves sleep-EEG in patients with depression: Journal of Psychiatric Research Vol 38(2) Mar-Apr 2004, 129-136.
  • Hennessy, M. B., Davis, H. N., McCrea, A. E., Harvey, A. T., & Williams, M. T. (1999). Short- and long-term consequences of corticotropin-releasing factor in early development. New York, NY: New York Academy of Sciences.
  • Hennessy, M. B., Long, S. J., Nigh, C. K., Williams, M. T., & Nolan, D. J. (1995). Effects of peripherally administered corticotropin-releasing factor (CRF) and a CRF antagonist: Does peripheral CRF activity mediate behavior of guinea pig pups during isolation? : Behavioral Neuroscience Vol 109(6) Dec 1995, 1137-1145.
  • Hennessy, M. B., McInturf, S. M., & Mazzei, S. J. (1997). Evidence that endogenous corticotropin-releasing factor suppresses behavioral responses of guinea pig pups to brief isolation in novel surroundings: Developmental Psychobiology Vol 31(1) Jul 1997, 39-47.
  • Henry, B., Vale, W., & Markou, A. (2006). The Effect of Lateral Septum Corticotropin-Releasing Factor Receptor 2 Activation on Anxiety is Modulated by Stress: Journal of Neuroscience Vol 26(36) Sep 2006, 9142-9152.
  • Herringa, R. J., Mackenrodt, D. B., Barlow, J. D., Roseboom, P. H., Nanda, S. A., & Kalin, N. H. (2006). Corticotropin-releasing factor (CRF), but not corticosterone, increases basolateral amygdala CRF-binding protein: Brain Research Vol 1083(1) Apr 2006, 21-28.
  • Herringa, R. J., Nanda, S. A., Hsu, D. T., Roseboom, P. H., & Kalin, N. H. (2004). The effects of acute stress on the regulation of central and basolateral amygdala CRF-binding protein gene expression: Molecular Brain Research Vol 131(1-2) Nov 2004, 17-25.
  • Heuser, I., Yassouridis, A., & Holsboer, F. (1994). The combined dexamethasone/CRH test: A refined laboratory test for psychiatric disorders: Journal of Psychiatric Research Vol 28(4) Jul-Aug 1994, 341-356.
  • Hewitt, S. A., & Bains, J. S. (2006). Brain-Derived Neurotrophic Factor Silences GABA Synapses Onto Hypothalamic Neuroendocrine Cells Through a Postsynaptic Dynamin-Mediated Mechanism: Journal of Neurophysiology Vol 95(4) Apr 2006, 2193-2198.
  • Hibbeln, J. R., Bissette, G., Umhau, J. C., & George, D. T. (2004). Omega-3 Status and Cerebrospinal Fluid Corticotrophin Releasing Hormone in Perpetrators of Domestic Violence: Biological Psychiatry Vol 56(11) Dec 2004, 895-897.
  • Hikichi, T., Akiyoshi, J., Yamamoto, Y., Tsutsumi, T., Isogawa, K., & Nagayama, H. (2000). Suppression of conditioned fear by administration of CRF receptor antagonist CP-154,526: Pharmacopsychiatry Vol 33(5) Sep 2000, 189-193.
  • Hiroi, N., Wong, M. L., Licinio, J., Park, C., Young, M., Gold, P. W., et al. (2001). Expression of corticotropin releasing hormone receptors type I and type II mRNA in suicide victims and controls: Molecular Psychiatry Vol 6(5) Sep 2001, 540-546.
  • Hodgson, R. A., Higgins, G. A., Guthrie, D. H., Lu, S. X., Pond, A. J., Mullins, D. E., et al. (2007). Comparison of the V1b antagonist, SSR149415, and the CRF1 antagonist, CP-154,526, in rodent models of anxiety and depression: Pharmacology, Biochemistry and Behavior Vol 86(3) Mar 2007, 431-440.
  • Hogan, J. B., Hodges, D. B., Jr., Lelas, S., Gilligan, P. J., McEiroy, J. F., & Lindner, M. D. (2005). Effects of CRF-sub-1 receptor antagonists and benzodiazepines in the Morris water maze and delayed non-matching to position tests: Psychopharmacology Vol 178(4) Apr 2005, 410-419.
  • Holahan, M. R., Kalin, N. H., & Kelley, A. E. (1997). Microinfusion of corticotropin-releasing factor into the nucleus accumbens shell results in increased behavioral arousal and oral motor activity: Psychopharmacology Vol 130(2) Mar 1997, 189-196.
  • Holsboer, F. (1999). The rationale for corticotropin-releasing hormone receptor (CRH-R) antagonists to treat depression and anxiety: Journal of Psychiatric Research Vol 33(3) May-Jun 1999, 181-214.
  • Hope, P. J., Turnbull, H., Farr, S., Morley, J. E., Rice, K. C., Chrousos, G. P., et al. (2000). Peripheral administration of CRF and urocortin: Effects on food intake and the HPA axis in the marsupial Sminthopsis crassicaudata: Peptides Vol 21(5) May 2000, 669-677.
  • Horgan, J., Miguel-Hidalgo, J. J., Thrasher, M., & Bissette, G. (2007). Longitudinal brain corticotropin releasing factor and somatostatin in a transgenic mouse (TG2576) model of Alzheimer's disease: Journal of Alzheimer's Disease Vol 12(2) 2007, 115-127.
  • Hotta, M., Shibasaki, T., Arai, K., & Demura, H. (1999). Corticotropin-releasing factor receptor type 1 mediates emotional stress-induced inhibition of food intake and behavioral changes in rats: Brain Research Vol 823(1-2) Mar 1999, 221-225.
  • Houshyar, H., Gomez, F., Manalo, S., Bhargava, A., & Dallman, M. F. (2003). Intermittent morphine administration induces dependence and is a chronic stressor in rats: Neuropsychopharmacology Vol 28(11) Nov 2003, 1960-1972.
  • Hsu, D. T. (2002). The dynamics of corticotropin-releasing hormone gene expression in the rat brain in response to stress. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Hsu, D. T., Chen, F.-L., Takahashi, L. K., & Kalin, N. H. (1998). Rapid stress-induced elevations in corticotropin-releasing hormone mRNA in rat central amygdala nucleus and hypothalamic paraventricular nucleus: An in situ hybridization analysis: Brain Research Vol 788(1-2) Mar 1998, 305-310.
  • Hucks, D., Lowther, S., Crompton, M. R., Katona, C. L. E., & Horton, R. W. (1997). Corticotropin-releasing factor binding sites in cortex of depressed suicides: Psychopharmacology Vol 134(2) Nov 1997, 174-178.
  • Hugin-Flores, M. E., Steimer, T., Schulz, P., Vallotton, M. B., & Aubert, M. L. (2003). Chronic corticotropin-releasing hormone and vasopressin regulate corticosteroid receptors in rat hippocampus and anterior pituitary: Brain Research Vol 976(2) Jun 2003, 159-170.
  • Huot, R. L., Gonzalez, M. E., Ladd, C. O., Thrivikraman, K. V., & Plotsky, P. M. (2004). Foster litters prevent hypothalamic-pituitary-adrenal axis sensitization mediated by neonatal maternal separation: Psychoneuroendocrinology Vol 29(2) Feb 2004, 279-289.
  • Husum, H., & Mathe, A. A. (2002). Early life stress changes concentrations of neuropeptide Y and corticotropin-releasing hormone in adult rat brain. Lithium treatment modifies these changes: Neuropsychopharmacology Vol 27(5) Nov 2002, 756-764.
  • Hwang, B. H., & Guntz, J. M. (1997). Downregulation of corticotropin-releasing factor mRNA, but not vasopressin mRNA, in the paraventricular hypothalamic nucleus of rats following nutritional stress: Brain Research Bulletin Vol 43(5) 1997, 509-514.
  • Hwang, B. H., Stewart, R., Zhang, J.-K., Lumeng, L., & Li, T. K. (2004). Corticotropin-releasing factor gene expression is down-regulated in the central nucleus of the amygdala of alcohol-preferring rats which exhibit high anxiety: A comparison between rat lines selectively bred for high and low alcohol preference: Brain Research Vol 1026(1) Nov 2004, 143-150.
  • Iijima, M., & Chaki, S. (2005). Separation-induced ultrasonic vocalization in rat pups: Further pharmacological characterization: Pharmacology, Biochemistry and Behavior Vol 82(4) Dec 2005, 652-657.
  • Iijima, M., & Chaki, S. (2007). An arginine vasopressin V-sub(1b) antagonist SSR149415 elicits antidepressant-like effects in an olfactory bulbectomy model: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 31(3) Apr 2007, 622-627.
  • Imaki, T., Katsumata, H., Konishi, S. l., Kasagi, Y., & Minami, S. (2003). Corticotropin-Releasing Factor Type-1 Receptor mRNA is Not Induced in Mouse Hypothalamus By Either Stress or Osmotic Stimulation: Journal of Neuroendocrinology Vol 15(10) Oct 2003, 916-924.
  • Imaki, T., & Vale, W. (1993). Chlordiazepoxide attenuates stress-induced accumulation of corticotropin-releasing factor mRNA in the paraventricular nucleus: Brain Research Vol 623(2) Oct 1993, 223-228.
  • Inoue, K., Valdez, G. R., Reyes, T. M., Reinhardt, L. E., Tabarin, A., Rivier, J., et al. (2003). Human Urocortin II, a Selective Agonist for the Type 2 Corticotropin-Releasing Factor Receptor, Decreases Feeding and Drinking in the Rat: Journal of Pharmacology and Experimental Therapeutics Vol 305(1) Apr 2003, 385-393.
  • Inui, A. (2001). Eating behavior in anorexia nervosa--an excess of both orexigenic and anorexigenic signalling? : Molecular Psychiatry Vol 6(6) Nov 2001, 620-624.
  • Ising, M., & Holsboer, F. (2007). CRH-sub-1 receptor antagonists for the treatment of depression and anxiety: Experimental and Clinical Psychopharmacology Vol 15(6) Dec 2007, 519-528.
  • Ising, M., Kunzel, H. E., Binder, E. B., Nickel, T., Modell, S., & Holsboer, F. (2005). The combined dexamethasone/CRH test as a potential surrogate marker in depression: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 29(6) Jul 2005, 1085-1093.
  • Isogawa, K., Akiyoshi, J., Tsutsumi, T., Kodama, K., Horinouti, Y., & Hagayam, H. (2003). Anxiogenic-like effect of corticotropin-releasing factor receptor 2 antisense oligonucleotides infused into rat brain: Journal of Psychopharmacology Vol 17(4) Dec 2003, 409-413.
  • Itoi, K., Jost, N., Tschope, C., Culman, J., & et al. (1994). Inhibition by morphine of the cardiovascular and behavioral responses evoked by centrally administered substance P in conscious rats: Neuropharmacology Vol 33(2) Feb 1994, 181-187.
  • Izzo, E., Sanna, P. P., & Koob, G. F. (2005). Impairment of dopaminergic system function after chronic treatment with corticotropin-releasing factor: Pharmacology, Biochemistry and Behavior Vol 81(4) Aug 2005, 701-708.
  • Jahn, H., Montkowski, A., Knaudt, K., Strohle, A., Kiefer, F., Schick, M., et al. (2001). alpha -Helical-corticotropin-releasing hormone reverses anxiogenic effects of C-type natriuretic peptide in rats: Brain Research Vol 893(1-2) Mar 2001, 21-28.
  • Jasnow, A. M., Banks, M. C., Owens, E. C., & Huhman, K. L. (1999). Differential effects of two corticotropin-releasing factor antagonists on conditioned defeat in male Syrian hamsters (Mesocricetus auratus): Brain Research Vol 846(1) Oct 1999, 122-128.
  • Jasnow, A. M., Davis, M., & Huhman, K. L. (2004). Involvement of Central Amygdalar and Bed Nucleus of the Stria Terminalis Corticotropin-Releasing Factor in Behavioral Responses to Social Defeat: Behavioral Neuroscience Vol 118(5) Oct 2004, 1052-1061.
  • Jasnow, A. M., Schulkin, J., & Pfaff, D. W. (2006). Estrogen facilitates fear conditioning and increases corticotropin-releasing hormone mRNA expression in the central amygdala in female mice: Hormones and Behavior Vol 49(2) Feb 2006, 197-205.
  • Jedema, H. P., Finlay, J. M., Sved, A. F., & Grace, A. A. (2001). Chronic cold exposure potentiates CRH-evoked increases in electrophysiologic activity of locus coeruleus neurons: Biological Psychiatry Vol 49(4) Feb 2001, 351-359.
  • Jedema, H. P., & Grace, A. A. (2004). Corticotropin-Releasing Hormone Directly Activates Noradrenergic Neurons of the Locus Ceruleus Recorded In Vitro: Journal of Neuroscience Vol 24(43) 2004, 9703-9713.
  • Ji, D., Gilpin, N. W., Richardson, H. N., Rivier, C. L., & Koob, G. F. (2008). Effects of naltrexone, duloxetine, and a corticotropin-releasing factor type 1 receptor antagonist on binge-like alcohol drinking in rats: Behavioural Pharmacology Vol 19(1) Feb 2008, 1-12.
  • Jochman, K. A. (2004). The functional role of the corticotropin-releasing factor (CRF) system in the amygdala: Molecular, behavioral, and anatomical studies. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Jochman, K. A., Newman, S. M., Kalin, N. H., & Bakshi, V. P. (2005). Corticotropin-Releasing Factor-1 Receptors in the Basolateral Amygdala Mediate Stress-Induced Anorexia: Behavioral Neuroscience Vol 119(6) Dec 2005, 1448-1458.
  • Johnstone, H. A., Wigger, A., Douglas, A. J., Neumann, I. D., Landgraf, R., Seckl, J. R., et al. (2000). Attenuation of Hypothalamic-Pituitary-Adrenal Axis Stress Responses in Late Pregnancy: Changes in Feedforward and Feedback Mechanisms: Journal of Neuroendocrinology Vol 12(8) Aug 2000, 811-822.
  • Jones, D. N. C., Kortekaas, R., Slade, P. D., Middlemiss, D. N., & Hagan, J. J. (1998). The behavioural effects of corticotropin-releasing factor-related peptides in rats: Psychopharmacology Vol 138(2) Jul 1998, 124-132.
  • Jousisto-Hanson, J., Stenfors, C., Theodorsson, E., & Mathe, A. A. (1994). Effect of lithium on rat brain neurotensin, corticotropin releasing factor, somatostatin and vasoactive intestinal peptide: Lithium Vol 5(2) May 1994, 83-90.
  • Jutkiewicz, E. M., Wood, S. K., Houshyar, H., Hsin, L.-W., Rice, K. C., & Woods, J. H. (2005). The effects of CRF antagonists, antalarmin, CP154,526, LWH234, and R121919, in the forced swim test and on swim-induced increases in adrenocorticotropin in rats: Psychopharmacology Vol 180(2) Jul 2005, 215-223.
  • Kagamiishi, Y., Yamamoto, T., & Watanabe, S. (2003). Hippocampal serotonergic system is involved in anxiety-like behavior induced by corticotropin-releasing factor: Brain Research Vol 991(1-2) Nov 2003, 212-221.
  • Kalin, N. H., Shelton, S. E., & Davidson, R. J. (2000). Cerebrospinal fluid corticotropin-releasing hormone levels are elevated in monkeys with patterns of brain activity associated with fearful temperament: Biological Psychiatry Vol 47(7) Apr 2000, 579-585.
  • Kalin, N. H., Takahashi, L. K., & Chen, F.-L. (1994). Restraint stress increases corticotropin-releasing hormone mRNA content in the amygdala and paraventricular nucleus: Brain Research Vol 656(1) Sep 1994, 182-186.
  • Kammerer, M., Taylor, A., & Glover, V. (2006). The HPA axis and perinatal depression: A hypothesis: Archives of Women's Mental Health Vol 9(4) Jul 2006, 187-196.
  • Kaneta, T., & Kusnecov, A. W. (2005). The role of central corticotropin-releasing hormone in the anorexic and endocrine effects of the bacterial T cell superantigen, Staphylococcal enterotoxin A: Brain, Behavior, and Immunity Vol 19(2) Mar 2005, 138-146.
  • Kang, J.-E., Cirrito, J. R., Dong, H., Csernansky, J. G., & Holtzman, D. M. (2007). Acute stress increases interstitial fluid amyloid-beta via corticotropin-releasing factor and neuronal activity: PNAS Proceedings of the National Academy of Sciences of the United States of America Vol 104(25) Jun 2007, 10673-10678.
  • Kasahara, M., Groenink, L., Breuer, M., Olivier, B., & Sarnyai, Z. (2007). Altered behavioural adaptation in mice with neural corticotrophin-releasing factor overexpression: Genes, Brain & Behavior Vol 6(7) Oct 2007, 598-607.
  • Kasckow, J., Mulchahey, J. J., Aguilera, G., Pisarska, M., Nikodemova, M., Chen, H. C., et al. (2003). Corticotropin-Releasing Hormone (CRH) Expression and Protein Kinase A Mediated CRH Receptor Signalling in an Immortalized Hypothalaimic Cell Line: Journal of Neuroendocrinology Vol 15(5) May 2003, 521-529.
  • Kasckow, J. W., Aguilera, G., Mulchahey, J. J., Sheriff, S., & Herma, J. P. (2003). In vitro regulation of corticotropin-releasing hormone: Life Sciences Vol 73(6) Jun 2003, 769-781.
  • Kasckow, J. W., Baker, D., & Geracioti, T. D., Jr. (2001). Corticotropin-releasing hormone in depression and post-traumatic stress disorder: Peptides Vol 22(5) May 2001, 845-851.
  • Kasckow, J. W., Regmi, A., Seasholtz, A. F., & Mulchahey, J. J. (1999). Regulation of Corticotropin-Releasing Factor-Binding Protein Expression in Amygdalar Neuronal Cultures: Journal of Neuroendocrinology Vol 11(12) Dec 1999, 959-966.
  • Kastin, A. J., Akerstrom, V., & Pan, W. (2000). Activation of urocortin transport into brain by leptin: Peptides Vol 21(12) Dec 2000, 1811-1817.
  • Kawashima, H., Saito, T., Yoshizato, H., Fujikawa, T., Sato, Y., McEwen, B. S., et al. (2004). Endurance treadmill training in rats alters CRH activity in the hypothalamic paraventricular nucleus at rest and during acute running according to its period: Life Sciences Vol 76(7) Dec 2004, 763-774.
  • Keck, M. E., & Holsboer, F. (2001). Hyperactivity of CRH neuronal circuits as a target for therapeutic interventions in affective disorders: Peptides Vol 22(5) May 2001, 835-844.
  • Keck, M. E., Ohl, F., Holsboer, F., & Muller, M. B. (2005). Listening to mutant mice: A spotlight on the role of CRF/CRF receptor systems in affective disorders: Neuroscience & Biobehavioral Reviews Vol 29(4-5) 2005, 867-889.
  • Keck, M. E., Welt, T., Wigger, A., Renner, U., Engelmann, M., Holsboer, F., et al. (2001). The anxiolytic effect of the CRH-sub-1 receptor antagonist R121919 depends on innate emotionality in rats: European Journal of Neuroscience Vol 13(2) Jan 2001, 373-380.
  • Keck, M. E., Wigger, A., Welt, T., Muller, M. B., Gesing, A., Reul, J. M. H. M., et al. (2002). Vasopressin mediates the response of the combined dexamethasone/CRH test in hyper-anxious rats: Implications for pathogenesis of affective disorders: Neuropsychopharmacology Vol 26(1) Jan 2002, 94-105.
  • Kehne, J. H., Coverdale, S., McCloskey, T. C., Hoffman, D. C., & Cassella, J. V. (2000). Effects of the CRF-sub-1 receptor antagonist, CP 154,526, in the separation-induced vocalization anxiolytic test in rat pups: Neuropharmacology Vol 39(8) Jun 2000, 1357-1367.
  • Kehne, J. H., Hoffman, D., & Baron, B. (2005). CRF-sub-1 Receptor Antagonists for the Treatment of Anxiety, Depression, and Stress Disorders: An Update. Hauppauge, NY: Nova Science Publishers.
  • Kellner, M., Herzog, L., Holsboer, F., & Wiedemann, K. (1995). Circadian changes in the sensitivity of the corticotropin-releasing hormone-stimulated HPA system after arginine vasopressin and atrial natriuretic hormones in human male controls: Psychoneuroendocrinology Vol 20(5) 1995, 515-524.
  • Kellner, M., Schick, M., Yassouridis, A., Struttmann, T., Wiedemann, K., & Alm, B. (2004). Metyrapone Tests in Patients with Panic Disorder: Biological Psychiatry Vol 56(11) Dec 2004, 898-900.
  • Kellner, M., Yassouridis, A., Hubner, R., Baker, D. G., & Wiedemann, K. (2003). Endocrine and cardiovascular responses to corticotropin-releasing hormone in patients with posttraumatic stress disorder: A role for atrial natriuretic peptide? : Neuropsychobiology Vol 47(2) Apr 2003, 102-108.
  • Kellner, M., & Yehuda, R. (1999). Do panic disorder and posttraumatic stress disorder share a common psychoneuroendocrinology? : Psychoneuroendocrinology Vol 24(5) Jul 1999, 485-504.
  • Keltner, N. L., & Dowben, J. S. (2007). Psychobiological Substrates of Posttraumatic Stress Disorder--Part I: Perspectives in Psychiatric Care Vol 43(2) Apr 2007, 97-101.
  • Khan, S. (2004). Mediating role of corticotropin-releasing hormone (CRH) in anxiety and ischemia: Behavioural and physiological correlates. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Kikusui, T., Takeuchi, Y., & Mori, Y. (2000). Involvement of corticotropin-releasing factor in the retrieval process of fear-conditioned ultrasonic vocalization in rats: Physiology & Behavior Vol 71(3-4) Nov 2000, 323-328.
  • Kim, S.-J., Park, S.-H., Choi, S.-h., Moon, B.-H., Lee, K.-J., Kang, S. W., et al. (2006). Effects of repeated tianeptine treatment on CRF mRNA expression in non-stressed and chronic mild stress-exposed rats: Neuropharmacology Vol 50(7) Jun 2006, 824-833.
  • Kinsey-Jones, J. S., Li, X. F., Bowe, J. E., Lightman, S. L., & O'Byrne, K. T. (2006). Corticotrophin-releasing factor type 2 receptor-mediated suppression of gonadotrophin-releasing hormone mRNA expression in GT1-7 cells: Stress: The International Journal on the Biology of Stress Vol 9(4) Dec 2006, 215-222.
  • Kirby, L. G., Rice, K. C., & Valentino, R. J. (2000). Effects of corticotropin-releasing factor on neuronal activity in the serotonergic dorsal raphe nucleus: Neuropsychopharmacology Vol 22(2) Feb 2000, 148-162.
  • Kirby, L. G., Rice, K. C., & Valentino, R. J. (2000). "Effects of corticotropin-releasing factor on neuronal activity in the serotonergic dorsal raphe nucleus": Erratum: Neuropsychopharmacology Vol 22(4) Apr 2000, 449.
  • Kiss, A., Jezova, D., & Aguilera, G. (1994). Activity of the hypothalamic pituitary adrenal axis and sympathoadrenal system during food and water deprivation in the rat: Brain Research Vol 663(1) Nov 1994, 84-92.
  • Kita, I., Seki, Y., Nakatani, Y., Fumoto, M., Oguri, M., Sato-Suzuki, I., et al. (2006). Corticotropin-releasing factor neurons in the hypothalamic paraventricular nucleus are involved in arousal/yawning response of rats: Behavioural Brain Research Vol 169(1) Apr 2006, 48-56.
  • Kling, M. A., Gardner, D. L., Calogero, A. E., Coppola, R., & et al. (1994). Effects of local anesthetics on experiential, physiologic and endocrine measures in healthy humans and on rat hypothalamic corticotropin-releasing hormone release in vitro: Clinical and psychobiologic implications: Journal of Pharmacology and Experimental Therapeutics Vol 268(3) Mar 1994, 1548-1564.
  • Kling, M. A., Geracioti, T. D., Licinio, J., Michelson, D., & et al. (1994). Effects of electroconvulsive therapy on the CRH-ACTH-cortisol system in melancholic depression: Preliminary findings: Psychopharmacology Bulletin Vol 30(3) 1994, 489-494.
  • Kochavi, D., Davis, J. D., & Smith, G. P. (2001). Corticotropin-releasing factor decreases meal size by decreasing cluster number in Koletsky (LA/N) rats with and without a null mutation of the leptin receptor: Physiology & Behavior Vol 74(4-5) Nov-Dec 2001, 645-651.
  • Koob, G., & Kreek, M. J. (2007). Stress, dysregulation of drug reward pathways, and the transition to drug dependence: American Journal of Psychiatry Vol 164(8) Aug 2007, 1149-1159.
  • Koob, G. F. (1999). Corticotropin-releasing factor, norepinephrine, and stress: Biological Psychiatry Vol 46(9) Nov 1999, 1167-1180.
  • Koob, G. F. (1999). Stress, corticotropin-releasing factor, and drug addiction. New York, NY: New York Academy of Sciences.
  • Koob, G. F. (2008). Alcoholism, corticotropin-releasing factor, and molecular genetic allostasis: Biological Psychiatry Vol 63(2) Jan 2008, 137-138.
  • Koob, G. F., Bartfai, T., & Roberts, A. J. (2001). Molecular genetic approaches to the neuropharmacology of corticotropin-releasing factor: International Journal of Comparative Psychology Vol 14(3-4) 2001, 90-110.
  • Koob, G. F., & Heinrichs, S. C. (1999). A role for corticotropin releasing factor and urocortin in behavioral responses to stressors: Brain Research Vol 848(1-2) Nov 1999, 141-152.
  • Korte, S. M., Korte-Bouws, G. A. H., Bohus, B., & Koob, G. F. (1994). Effect of corticotropin-releasing factor antagonist on behavioral and neuroendocrine responses during exposure to defensive burying paradigm in rats: Physiology & Behavior Vol 56(1) Jul 1994, 115-120.
  • Kortekaas, R., Costall, B., & Smythe, J. W. (1999). Changes in hippocampal theta following intrahippocampal corticotropin-releasing hormone (CRH) infusions in the rat: Brain Research Bulletin Vol 48(6) Apr 1999, 603-607.
  • Kosa, E., Marcilhac-Flouriot, A., Fache, M.-P., & Siaud, P. (2000). Effects of beta -phenylethylamine on the hypothalamo-pituitary-adrenal axis in the male rat: Pharmacology, Biochemistry and Behavior Vol 67(3) Nov 2000, 527-535.
  • Kovacs, K. J., Foldes, A., & Sawchenko, P. E. (2000). Glucocorticoid negative feedback selectively targets vasopressin transcription in parvocellular neurosecretory neurons: Journal of Neuroscience Vol 20(10) May 2000, 3843-3852.
  • Krieg, J.-C. (1994). Laboratory tests in depression: Is it worth the effort? : Journal of Psychiatric Research Vol 28(4) Jul-Aug 1994, 337-339.
  • Ku, Y. H., Tan, L., Li, L. S., & Ding, X. (1998). Role of corticotropin-releasing factor and substance P in pressor responses of nuclei controlling emotion and stress: Peptides Vol 19(4) 1998, 677-682.
  • Kunugi, H., Urushibara, T., & Nanko, S. (2004). Combined DEX/CRH test among Japanese patients with major depression: Journal of Psychiatric Research Vol 38(2) Mar-Apr 2004, 123-128.
  • Kunzel, H. E., Binder, E. B., Nickel, T., Ising, M., Fuchs, B., Majer, M., et al. (2003). Pharmacological and Nonpharmacological Factors Influencing Hypothalamic-Pituitary-Adrenocortical Axis Reactivity in Acutely Depressed Psychiatric In-patients, Measured by the Dex-CRH Test: Neuropsychopharmacology Vol 28(12) Dec 2003, 2169-2178.
  • Kunzel, H. E., Ising, M., Zobel, A. W., Nickel, T., Ackl, N., Sonntag, A., et al. (2005). Treatment with a CRH-1-receptor antagonist (R121919) does not affect weight or plasma leptin concentration in patients with major depression: Journal of Psychiatric Research Vol 39(2) Mar 2005, 173-177.
  • Kusnecov, A. W., Liang, R., & Shurin, G. (1999). T-lymphocyte activation increases hypothalamic and amygdaloid expression of CRH mRNA and emotional reactivity to novelty: Journal of Neuroscience Vol 19(11) Jun 1999, 4533-4543.
  • Lahmame, A., Grigoriadis, D. E., De Souza, E. B., & Armario, A. (1997). Brain corticotropin-releasing factor immunoreactivity and receptors in five inbred rat strains: Relationship to forced swimming behaviour: Brain Research Vol 750(1-2) Mar 1997, 285-292.
  • Lammers, C.-H., Garcia-Borreguero, D., Schmider, J., Gotthardt, U., Dettling, M., Holsboer, F., et al. (1995). Combined dexamethasone/corticopin-releasing hormone test in patients with schizophrenia and in normal controls: II: Biological Psychiatry Vol 38(12) Dec 1995, 803-807.
  • Lammers, C.-H., & Heuser, I. (1996). "Hypothalamic-pituitary-adrenal axis in schizophrenia.": Response: Biological Psychiatry Vol 40(6) Sep 1996, 561.
  • Lancel, M., Muller-Preuss, P., Wigger, A., Landgraf, R., & Holsboer, F. (2002). The CRH1 receptor antagonist R121919 attenuates stress-elicited sleep disturbances in rats, particularly in those with high innate anxiety: Journal of Psychiatric Research Vol 36(4) Jul-Aug 2002, 197-208.
  • Laugero, K. D. (2001). A New Perspective on Glucocorticoid Feedback: Relation to Stress, Carbohydrate Feeding and Feeling Better: Journal of Neuroendocrinology Vol 13(9) Sep 2001, 827-835.
  • Laugero, K. D. (2001). "A new perspective on glucocorticoid feedback: Relation to stress, carbohydrate feeding and feeling better": Erratum: Journal of Neuroendocrinology Vol 13(12) Dec 2001, 1088.
  • Lautenbacher, S., Roscher, S., Kohl, G., Vedder, H., & Krieg, J.-C. (1999). Corticotropin-releasing-hormone lacks analgesic properties: An experimental study in humans, using non-inflammatory pain: Pain Vol 83(1) Oct 1999, 1-7.
  • Le, A. D., Harding, S., Juzytsch, W., Watchus, J., Shalev, U., & Shaham, Y. (2000). The role of corticotrophin-releasing factor in stress-induced relapse to alcohol-seeking behavior in rats: Psychopharmacology Vol 150(3) Jun 2000, 317-324.
  • Le Dzung, A., Funk, D., Harding, S., Juzytsch, W., Li, Z., & Fletcher, P. J. (2008). Intra-median raphe nucleus (MRN) infusions of muscimol, a GABA-A receptor agonist, reinstate alcohol seeking in rats: Role of impulsivity and reward: Psychopharmacology Vol 195(4) Jan 2008, 605-615.
  • Lee, E. H. Y., Change, S. Y., & Chen, A. Y. J. (1994). CRF facilitates NE release from the hippocampus: A microdialysis study: Neuroscience Research Vol 19(3) May 1994, 327-330.
  • Lee, R., Geracioti, T. D., Jr., Kasckow, J. W., & Coccaro, E. F. (2005). Childhood Trauma and Personality Disorder: Positive Correlation With Adult CSF Corticotropin-Releasing Factor Concentrations: American Journal of Psychiatry Vol 162(5) May 2005, 995-997.
  • Lee, R. J., Gollan, J., Kasckow, J., Geracioti, T., & Coccaro, E. F. (2006). CSF Corticotropin-Releasing Factor in Personality Disorder: Relationship with Self-Reported Parental Care: Neuropsychopharmacology Vol 31(10) Oct 2006, 2289-2295.
  • Lee, Y. (1996). Neural substrates underlying CRH-enhanced startle: An anatomical and pharmacological study of an animal model of anxiety. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Lee, Y., & Davis, M. (1997). Role of the hippocampus, the bed nucleus of the stria terminalis, and the amygdala in the excitatory effect of corticotropin-releasing hormone on the acoustic startle reflex: Journal of Neuroscience Vol 17(16) Aug 1997, 6434-6446.
  • Lee, Y., & Davis, M. (1997). Role of the septum in the excitatory effect of corticotropin-releasing hormone on the acoustic startle reflex: Journal of Neuroscience Vol 17(16) Aug 1997, 6424-6433.
  • Lee, Y., Schulkin, J., & Davis, M. (1994). Effect of corticosterone on the enhancement of the acoustic startle reflex by corticotropin releasing factor (CRF): Brain Research Vol 666(1) Dec 1994, 93-98.
  • Lelas, S., Zeller, K. L., Ward, K. A., & McElroy, J. F. (2003). The anxiolytic CRF-sub-1 antagonist DMP696 fails to function as a discriminative stimulus and does not substitute for chlordiazepoxide in rats: Psychopharmacology Vol 166(4) Apr 2003, 408-415.
  • Leonard, B. E. (2001). Changes in the immune system in depression and dementia: Causal or co-incidental effects? : International Journal of Developmental Neuroscience Vol 19(3) Jun 2001, 305-312.
  • Licinio, J., O'Kirwan, F., Irizarry, K., Merriman, B., Thakur, S., Jepson, R., et al. (2004). Association of a corticotropin-releasing hormone receptor 1 haplotype and antidepressant treatment response in Mexican-Americans: Molecular Psychiatry Vol 9(12) Dec 2004, 1075-1082.
  • Liebsch, G., Landgraf, R., Engelmann, M., Lorscher, P., & Holsboer, F. (1999). Differential behavioural effects of chronic infusion of CRH 1 and CRH 2 receptor antisense oligonucleotides into the rat brain: Journal of Psychiatric Research Vol 33(2) Mar-Apr 1999, 153-163.
  • Likar, R., Mousa, S. A., Steinkellner, H., Koppert, W., Philippitsch, G., Stein, C., et al. (2007). Involvement of Intra-articular Corticotropin-releasing Hormone in Postoperative Pain Modulation: Clinical Journal of Pain Vol 23(2) Feb 2007, 136-142.
  • Lim, M. M., Liu, Y., Ryabinin, A. E., Bai, Y., Wang, Z., & Young, L. J. (2007). CRF receptors in the nucleus accumbens modulate partner preference in prairie voles: Hormones and Behavior Vol 51(4) Apr 2007, 508-515.
  • Lim, M. M., Tsivkovskaia, N. O., Bai, Y., Young, L. J., & Ryabinin, A. E. (2006). Distribution of Corticotropin-Releasing Factor and Urocortin 1 in the Vole Brain: Brain, Behavior and Evolution Vol 68(4) Oct 2006, 229-240.
  • Linthorst, A. C. E., Flachskamm, C., Hopkins, S. J., Hoadley, M. E., & et al. (1997). Long-term intracerebroventricular infusion of corticotropin-releasing hormone alters neuroendocrine, neurochemical, autonomic, behavioral, and cytokine responses to a systemic inflammatory challenge: Journal of Neuroscience Vol 17(11) Jun 1997, 4448-4460.
  • Linthorst, A. C. E., Penalva, R. G., Flachskamm, C., Holsboer, F., & Reul, J. M. H. M. (2002). Forced swim stress activates rat hippocampal serotonergic neurotransmission involving a corticotropin-releasing hormone receptor-dependent mechanism: European Journal of Neuroscience Vol 16(12) Dec 2002, 2441-2452.
  • Liu, J., Yu, B., Neugebauer, V., Grigoriadis, D. E., Rivier, J., Vale, W. W., et al. (2004). Corticotropin-Releasing Factor and Urocortin I Modulate Excitatory Glutamatergic Synaptic Transmission: Journal of Neuroscience Vol 24(16) Apr 2004, 4020-4029.
  • Liu, J., Yu, B., Orozco-Cabal, L., Grigoriadis, D. E., Rivier, J., Vale, W. W., et al. (2005). Chronic Cocaine Administration Switches Corticotropin- Releasing Factor-sub-2 Receptor-Mediated Depression to Facilitation of Glutamatergic Transmission in the Lateral Septum: Journal of Neuroscience Vol 25(3) Jan 2005, 577-583.
  • Liu, X., & Weiss, F. (2002). Additive Effect of Stress and Drug Cues on Reinstatement of Ethanol Seeking: Exacerbation by History of Dependence and Role of Concurrent Activation of Corticotropin-Releasing Factor and Opioid Mechanisms: Journal of Neuroscience Vol 22(18) Sep 2002, 7856-7861.
  • Liu, Y., Curtis, J. T., Fowler, C. D., Spencer, C., Houpt, T., & Wang, Z. X. (2001). Differential expression of vasopressin, oxytocin and corticotrophin-releasing hormone messenger RNA in the paraventricular nucleus of the prairie vole brain following stress: Journal of Neuroendocrinology Vol 13(12) Dec 2001, 1059-1065.
  • Lodge, D. J., & Grace, A. A. (2005). Acute and Chronic Corticotropin-Releasing Factor 1 Receptor Blockade Inhibits Cocaine-Induced Dopamine Release: Correlation with Dopamine Neuron Activity: Journal of Pharmacology and Experimental Therapeutics Vol 314(1) Jul 2005, 201-206.
  • Loosen, P. T., Chambliss, B., Ekhator, N., Burns, D., & et al. (1993). Thyroid and adrenal dysfunction in abstinent alcoholic men: Locus of disturbance: Neuropsychopharmacology Vol 9(4) Dec 1993, 255-266.
  • Louis, C., Cohen, C., Depoortere, R., & Griebel, G. (2006). Antidepressant-Like Effects of the Corticotropin-Releasing Factor 1 Receptor Antagonist, SSR125543, and the Vasopressin 1b Receptor Antagonist, SSR1494I5, in a DRL-72 s Schedule in the Rat: Neuropsychopharmacology Vol 31(10) Oct 2006, 2180-2187.
  • Lowry, C. A., Burke, K. A., Renner, K. J., Moore, F. L., & Orchinik, M. (2001). Rapid changes in monoamine levels following administration of corticotropin-releasing factor or corticosterone are localized in the dorsomedial hypothalamus: Hormones and Behavior Vol 39(3) May 2001, 195-205.
  • Lowry, C. A., Rose, J. D., & Moore, F. L. (1996). Corticotropin-releasing factor enhances locomotion and medullary neuronal firing in an amphibian: Hormones and Behavior Vol 30(1) Mar 1996, 50-59.
  • Lu, L., Ceng, X., & Huang, M. (2000). Corticotropin-releasing factor receptor type 1 mediates stress-induced relapse to piate dependence in rats: Neuroreport: For Rapid Communication of Neuroscience Research Vol 11(11) Aug 2000, 2373-2378.
  • Lu, L., Liu, D., Ceng, X., & Ma, L. (2000). Differential roles of corticotropin-releasing factor receptor subtypes 1 and 2 in opiate withdrawal and in relapse to opiate dependence: European Journal of Neuroscience Vol 12(12) Dec 2000, 4398-4404.
  • Lyons, D. M., Yang, C., Mobley, B. W., Nickerson, J. T., & Schatzberg, A. F. (2000). Early Environmental Regulation of Glucocorticoid Feedback Sensitivity in Young Adult Monkeys: Journal of Neuroendocrinology Vol 12(8) Aug 2000, 723-728.
  • Macey, D. J., Koob, G. F., & Markou, A. (2000). CRF and urocortin decreased brain stimulation reward in the rat: Reversal by a CRF receptor antagonist: Brain Research Vol 866(1-2) Jun 2000, 82-91.
  • Maciag, C. M., Dent, G., Gilligan, P., He, L., Dowling, K., Ko, T., et al. (2002). Effects of a non-peptide CRF antagonist (DMP696) on the behavioral and endocrine sequelae of maternal separation: Neuropsychopharmacology Vol 26(5) May 2002, 574-582.
  • Maestripieri, D., Lindell, S. G., Ayala, A., Gold, P. W., & Higley, J. D. (2005). Neurobiological characteristics of rhesus macaque abusive mothers and their relation to social and maternal behavior: Neuroscience & Biobehavioral Reviews Vol 29(1) Feb 2005, 51-57.
  • Maier, S. F., & Watkins, L. R. (2005). Stressor controllability and learned helplessness: The roles of the dorsal raphe nucleus, serotonin, and corticotropin-releasing factor: Neuroscience & Biobehavioral Reviews Vol 29(4-5) 2005, 829-841.
  • Makino, S., Gold, P. W., & Schulkin, J. (1994). Corticosterone effects on corticotropin-releasing hormone mRNA in the central nucleus of the amydgala and the parvocellular region of the paraventricular nucleus of the hypothalamus: Brain Research Vol 640(1-2) Mar 1994, 105-112.
  • Makino, S., Hashimoto, K., & Gold, P. W. (2002). Multiple feedback mechanisms activating corticotropin-releasing hormone system in the brain during stress: Pharmacology, Biochemistry and Behavior Vol 73(1) Aug 2002, 147-158.
  • Makino, S., Shibasaki, T., Yamauchi, N., Nishioka, T., Mimoto, T., Wakabayashi, I., et al. (1999). Psychological stress increased corticotropin-releasing hormone mRNA and content in the central nucleus of the amygdala but not in the hypothalamic paraventricular nucleus in the rat: Brain Research Vol 850(1-2) Dec 1999, 136-143.
  • Malagoli, D., Mandrioli, M., & Ottaviani, E. (2004). ProCRH in the teleost Ameiurus nebulosus : gene cloning and role in LPS-induced stress response: Brain, Behavior, and Immunity Vol 18(5) Sep 2004, 451-457.
  • Mallo, T., Berggard, C., Eller, M., Damberg, M., Oreland, L., & Harro, J. (2004). Effect of long-term blockade of CRF-sub-1 receptors on exploratory behaviour, monoamines and transcription factor AP-2: Pharmacology, Biochemistry and Behavior Vol 77(4) Apr 2004, 855-865.
  • Mancuso, R. A., Schetter, C. D., Rini, C. M., Roesch, S. C., & Hobel, C. J. (2004). Maternal prenatal anxiety and corticotropin-releasing hormone associated with timing of delivery: Psychosomatic Medicine Vol 66(5) Sep-Oct 2004, 762-769.
  • Marcilhac, A., Dakine, N., Bourhim, N., Guillaume, V., Grino, M., Drieu, K., et al. (1998). Effect of chronic administration of ginkgo biloba extract or ginkgolide on the hypothalamic-pituitary-adrenal axis in the rat: Life Sciences Vol 62(25) May 1998, 2329-2340.
  • Marini, F., Pozzato, C., Andreetta, V., Jansson, B., Arban, R., Domenici, E., et al. (2006). Single exposure to social defeat increases corticotropin-releasing factor and glucocorticoid receptor mRNA expression in rat hippocampus: Brain Research Vol 1067(1) Jan 2006, 25-35.
  • Martins, A. P., Marras, R. A., & Guimaraes, F. S. (1997). Anxiogenic effect of corticotropin-releasing hormone in the dorsal periaqueductal grey: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 8(16) Nov 1997, 3601-3604.
  • Mathew, S. J., Coplan, J. D., Smith, E. L. P., Scharf, B. A., Owens, M. J., Nemeroff, C. B., et al. (2002). Cerebrospinal fluid concentrations of biogenic amines and corticotropin-releasing factor in adolescent non-human primates as a function of the timing of adverse early rearing: Stress: The International Journal on the Biology of Stress Vol 5(3) 2002, 185-193.
  • Matsumoto, K., Ojima, K., & Watanabe, H. (1997). Central corticotropin-releasing factor and benzodiazepine receptor systems are involved in the social isolation stress-induced decrease in ethanol sleep in mice: Brain Research Vol 753(2) Apr 1997, 318-321.
  • McCleery, J. M., & Goodwin, G. M. (2001). High and low neuroticism predict different cortisol responses to the combined dexamethasone-CRH test: Biological Psychiatry Vol 49(5) Mar 2001, 410-415.
  • McDonald, A. J., Mascagni, F., & Wilson, M. A. (1994). A sexually dimorphic population of CRF neurons in the medial preoptic area: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 5(5) Jan 1994, 653-656.
  • McElroy, J. F., Ward, K. A., Zeller, K. L., Jones, K. W., Gilligan, P. J., He, L., et al. (2002). The CRF-sub-1 receptor antagonist DMP696 produces anxiolytic effects and inhibits the stress-induced hypothalamic-pituitary-adrenal axis activation without sedation or ataxia in rats: Psychopharmacology Vol 165(1) Dec 2002, 86-92.
  • McInturf, S. M., & Hennessy, M. B. (1996). Peripheral administration of a corticotroin-releasing factor antagonist increases the vocalizing and locomotor activity of isolated guinea pig pups: Physiology & Behavior Vol 60(3) Sep 1996, 707-710.
  • McLean, S. A., Williams, D. A., Stein, P. K., Harris, R. E., Lyden, A. K., Whalen, G., et al. (2006). Cerebrospinal Fluid Corticotropin-Releasing Factor Concentration is Associated with Pain but not Fatigue Symptoms in Patients with Fibromyalgia: Neuropsychopharmacology Vol 31(12) Dec 2006, 2776-2782.
  • Meaney, M. J. (2000). Stress: Definition and physiology: Kazdin, Alan E (Ed).
  • Meller, W. H., Kathol, R. G., Samuelson, S. D., Gehris, T. L., & et al. (1995). CRH challenge test in anxious depression: Biological Psychiatry Vol 37(6) Mar 1995, 376-382.
  • Mello, N. K., Negus, S. S., Rice, K. C., & Mendelson, J. H. (2006). Effects of the CRF-sub-1 antagonist antalarmin on cocaine self-administration and discrimination in rhesus monkeys: Pharmacology, Biochemistry and Behavior Vol 85(4) Dec 2006, 744-751.
  • Menzaghi, F., Heinrichs, S. C., Pich, E. M., Tilders, F. J. H., & et al. (1993). Functional impairment of hypothalamic corticotropin-releasing factor neurons with immunotargeted toxins enhances food intake induced by neuropeptide Y: Brain Research Vol 618(1) Jul 1993, 76-82.
  • Menzaghi, F., Heinrichs, S. C., Pich, E. M., Weiss, F., & Koob, G. F. (1993). The role of limbic and hypothalamic corticotropin-releasing factor in behavioral responses to stress. New York, NY: New York Academy of Sciences.
  • Menzaghi, F., Howard, R. L., Heinrichs, S. C., Vale, W., & et al. (1994). Characterization of a novel and potent corticotropin-releasing factor antagonist in rats: Journal of Pharmacology and Experimental Therapeutics Vol 269(2) May 1994, 564-572.
  • Merali, Z., Kent, P., Du, L., Hrdina, P., Palkovits, M., Faludi, G., et al. (2006). Corticotropin-Releasing Hormone, Arginine Vasopressin, Gastrin-Releasing Peptide, and Neuromedin B Alterations in Stress-Relevant Brain Regions of Suicides and Control Subjects: Biological Psychiatry Vol 59(7) Apr 2006, 594-602.
  • Merali, Z., Kent, P., Michaud, D., McIntyre, D., & Anisman, H. (2001). Differential impact of predator or immobilization stressors on central corticotropin-releasing hormone and bombesin-like peptides in Fast and Slow seizing rat: Brain Research Vol 906(1-2) Jul 2001, 60-73.
  • Merali, Z., Khan, S., Michaud, D. S., Shippy, S. A., & Anisman, H. (2004). Does amygdaloid corticotropin-releasing hormone (CRH) mediate anxiety-like behaviors? Dissociation of anxiogenic effects and CRH release: European Journal of Neuroscience Vol 20(1) Jul 2004, 229-239.
  • Merali, Z., McIntosh, J., Kent, P., Michaud, D., & Anisman, H. (1998). Aversive and appetitive events evoke the release of corticotropin-releasing hormone and bombesin-like peptides at the central nucleus of the amygdala: Journal of Neuroscience Vol 18(12) Jun 1998, 4758-4766.
  • Mercer, J. G., Lawrence, C. B., & Atkinson, T. (1996). Hypothalamic NPY and CRF gene expression in the food-deprived Syrian hamster: Physiology & Behavior Vol 60(1) Jul 1996, 121-127.
  • Michel, C., Frankham, P., & Cabanac, M. (2003). Salicylate as a partial inhibitor of emotional fever and body weight set-point in rats: Behavioral and neuroendocrine study: Physiology & Behavior Vol 78(3) Mar 2003, 357-363.
  • Millan, M. J., Brocco, M., Gobert, A., Dorey, G., Casara, P., & Dekeyne, A. (2001). Anxiolytic properties of the selective, non-peptidergic CRF-sub-1 antagonists, CP154,526 and DMP695: A comparison to other classes of anxiolytic agent: Neuropsychopharmacology Vol 25(4) Oct 2001, 585-600.
  • Million, M., Wang, L., Martinez, V., & Tache, Y. (2000). Differential Fos expression in the paraventricular nucleus of the hypothalamus, sacral parasympathetic nucleus and colonic motor response to water avoidance stress in Fischer and Lewis rats: Brain Research Vol 877(2) Sep 2000, 345-353.
  • Mimassi, N., Lancien, F., Mabin, D., Delarue, C., Conlon, J. M., & Le Mevel, J.-C. (2003). Induction of bradycardia in trout by centrally administered corticotropin-releasing-hormone (CRH): Brain Research Vol 982(2) Aug 2003, 211-218.
  • Mitchell, A. J. (1998). The role of corticotropin releasing factor in depressive illness: A critical review: Neuroscience & Biobehavioral Reviews Vol 22(5) 1998, 635-651.
  • Miyahara, S., Komori, T., Fujiwara, R., Shizuya, K., Yamamoto, M., Ohmori, M., et al. (1999). Effects of restraint stress on alpha -sub-1 adrenoceptor mRNA expression in the hypothalamus and midbraina of the rat: Brain Research Vol 843(1-2) Oct 1999, 130-135.
  • Miyazato, H., Skinner, R. D., & Garcia-Rill, E. (2000). Locus coeruleus involvement in the effects of immobilization stress on the P13 midlatency auditory evoked potential in the rat: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 24(7) Oct 2000, 1177-1201.
  • Mokrushin, A. A., & Shalyapina, V. G. (2004). Neurophysiological Effects of Corticotropin-Releasing Factor in Living Slices of the Olfactory Area of the Rat Cortex: Neuroscience and Behavioral Physiology Vol 34(1) Jan 2004, 1-4.
  • Monnikes, H., Schmidt, B. G., Tebbe, J., Bauer, C., & et al. (1994). Microinfusion of corticotropin releasing factor into the locus coeruleus/subcoeruleus nuclei stimulates colonic motor function in rats: Brain Research Vol 644(1) Apr 1994, 101-108.
  • Moreau, J.-L., Kilpatrick, G., & Jenck, F. (1997). Urocortin, a novel neuropeptide with anxiogenic-like properties: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 8(7) May 1997, 1697-1701.
  • Morris, J. F. (2001). How does the brain determine whether enhanced cognition or anxiety is the appropriate response to a stress? : Neuroreport: For Rapid Communication of Neuroscience Research Vol 12(6) May 2001, A35.
  • Mousa, S. A., Bopaiah, C. P., Richter, J. F., Yamdeu, R. S., & Schafer, M. (2007). Inhibition of inflammatory pain by CRF at peripheral, spinal and supraspinal sites: Involvement of areas coexpressing CRF receptors and opioid peptides: Neuropsychopharmacology Vol 32(12) Dec 2007, 2530-2542.
  • Moy, S. S., Knapp, D. J., Criswell, H. E., & Breese, G. R. (1997). Flumazenil blockade of anxiety following ethanol withdrawal in rats: Psychopharmacology Vol 131(4) Jun 1997, 354-360.
  • Muller, M. B., Keck, M. E., Zimmermann, S., Holsboer, F., & Wurst, W. (2000). Disruption of feeding behavior in CRH receptor I-deficient mice is dependent on glucocorticoids: Neuroreport: For Rapid Communication of Neuroscience Research Vol 11(9) Jun 2000, 1963-1966.
  • Muller, M. B., Zimmermann, S., Sillaber, I., Hagemeyer, T. P., Deussing, J. M., Timpl, P., et al. (2003). Limbic corticotropin-releasing hormone receptor 1 mediates anxiety-related behavior and hormonal adaptation to stress: Nature Neuroscience Vol 6(10) Oct 2003, 1100-1107.
  • Muramatsu, T., Inoue, K., Iwasaki, S., Yamauchi, T., Hayashi, T., & Kiriike, N. (2006). Corticotropin-releasing factor receptor type 1, but not type 2, in the ventromedial hypothalamus modulates dopamine release in female rats: Pharmacology, Biochemistry and Behavior Vol 85(2) Oct 2006, 435-440.
  • Musselman, D. L., & Nemeroff, C. B. (1993). The role of corticotropin-releasing factor in the pathophysiology of psychiatric disorders: Psychiatric Annals Vol 23(12) Dec 1993, 676-681.
  • Myers, D. A., Gibson, M., Schulkin, J., & Van-Meerveld, B. G. (2005). Corticosterone implants to the amygdala and type 1 CRH receptor regulation: Effects on behavior and colonic sensitivity: Behavioural Brain Research Vol 161(1) Jun 2005, 39-44.
  • Nakase, S., Kitayama, I., Soya, H., Hamanaka, K., & Nomura, J. (1998). Increased expression of magnocellular arginine vasopressin mRNA in paraventricular nuclues of stress-induced depression-model rats: Life Sciences Vol 63(1) May 1998, 23-31.
  • Nalivaiko, E., & Blessing, W. W. (2004). CRF1 receptor antagonist CP-154,526 reduces cardiovascular responses during acute psychological stress in rabbits: Brain Research Vol 1017(1-2) Aug 2004, 234-237.
  • Nasman, B., Olsson, T., Fagerlund, M., & Eriksson, S. (1996). Blunted adrenocorticotropin and increased adrenal steroid response to human corticotropin-releasing hormone in Alzheimer's disease: Biological Psychiatry Vol 39(5) Mar 1996, 311-318.
  • Nazarloo, H. P., Takao, T., Nanamiya, W., Asaba, K., De Souza, E. B., & Hashimoto, K. (2001). Effect of non-peptide corticotropin-releasing factor receptor type 1 antagonist on adrenocorticotropic hormone release and interleukin-1 receptors followed by stress: Brain Research Vol 902(1) May 2001, 119-126.
  • Neeck, G., & Riedel, W. (1999). Hormonal perturbations in fibromyalgia syndrome. New York, NY: New York Academy of Sciences.
  • Nemeroff, C. B. (1998). Psychopharmacology of affective disorders in the 21st century: Biological Psychiatry Vol 44(7) Oct 1998, 517-525.
  • Nemeroff, C. B. (1999). The preeminent role of neuropeptide systems in the early pathophysiology of Alzheimer disease: Up with corticotropin-releasing factor, down with acetycholine: Archives of General Psychiatry Vol 56(11) Nov 1999, 991-992.
  • Nemeroff, C. B., & Owens, M. J. (2004). Pharmacologic differences among the SSRIs: Focus on monoamine transporters and the HPA axis: CNS Spectrums Vol 9(6,Suppl4) Jun 2004, 23-31.
  • Newport, D. J., Heim, C., Owens, M. J., Ritchie, J. C., Ramsey, C. H., Bonsall, R., et al. (2003). Cerebrospinal fluid corticotropin-releasing factor (CRF) and vasopressin concentrations predict pituitary response in the CRF stimulation test: A multiple regression analysis: Neuropsychopharmacology Vol 28(3) Mar 2003, 569-576.
  • Neylan, T. C., Lenoci, M., Maglione, M. L., Rosenlicht, N. Z., Metzler, T. J., Otte, C., et al. (2003). Delta Sleep Response to Metyrapone in Post-Traumatic Stress Disorder: Neuropsychopharmacology Vol 28(9) Sep 2003, 1666-1676.
  • Nie, Z., Schweitzer, P., Roberts, A. J., Madamba, S. G., Moore, S. D., & Siggins, G. R. (2004). Ethanol Augments GABAergic Transmission in the Central Amygdala via CRF1 Receptors: Science Vol 303(5663) Mar 2004, 1512-1514.
  • Nijsen, M. J. M. A., Croiset, G., Diamant, M., De Wied, D., & Wiegant, V. M. (2001). CRH signalling in the bed nucleus of the stria terminalis is involved in stress-induced cardiac vagal activation in conscious rats: Neuropsychopharmacology Vol 24(1) Jan 2001, 1-10.
  • Nijsen, M. J. M. A., Croiset, G., Stam, R., Bruijnzeel, A., Diamant, M., de Wied, D., et al. (2000). The role of the CRH type 1 receptor in autonomic responses to corticotropin-releasing hormone in the rat: Neuropsychopharmacology Vol 22(4) Apr 2000, 388-399.
  • Nikisch, G., Agren, H., Eap, C. B., Czernik, A., Baumann, P., & Mathe, A. A. (2005). Neuropeptide Y and corticotropin-releasing hormone in CSF mark response to antidepressive treatment with citalopram: International Journal of Neuropsychopharmacology Vol 8(3) Sep 2005, 403-410.
  • Nishino, S., Mignot, E., Benson, K. L., & Zarcone, V. P., Jr. (1998). Cerebrospinal fluid prostaglandins and corticotropin releasing factor in schizophrenics and controls: Relationship to sleep architecture: Psychiatry Research Vol 78(3) May 1998, 141-150.
  • No authorship, i. (2008). In this issue-February 15th: Biological Psychiatry Vol 63(4) Feb 2008, 345-346.
  • Nomura, M., Saito, J., Ueta, Y., Muglia, L. J., Pfaff, D. W., & Ogawa, S. (2003). Enhanced Up-Regulation of Corticotropin-Releasing Hormone Gene Expression in Response to Restraint Stress in the Hypothalamic Paraventricular Nucleus of Oxytocin Gene-Deficient Male Mice: Journal of Neuroendocrinology Vol 15(11) Nov 2003, 1054-1061.
  • O'Brien, D., Skelton, K. H., Owens, M. J., & Nemeroff, C. B. (2001). Are CRF receptor antagonists potential antidepressants? : Human Psychopharmacology: Clinical and Experimental Vol 16(1) Jan 2001, 81-87.
  • O'Callaghan, M. J., Croft, A. P., Jacquot, C., & Little, H. J. (2005). The hypothalamopituitary-adrenal axis and alcohol preference: Brain Research Bulletin Vol 68(3) Dec 2005, 171-178.
  • Ohata, H., & Shibasaki, T. (2004). Effects of urocortin 2 and 3 on motor activity and food intake in rats: Peptides Vol 25(10) Oct 2004, 1703-1709.
  • Ohata, H., Suzuki, K., Oki, Y., & Shibasaki, T. (2000). Urocortin in the ventromedial hypothalamic nucleus acts as an inhibitor of feeding behavior in rats: Brain Research Vol 861(1) Apr 2000, 1-7.
  • Ohgushi, A., Bungo, T., Shimojo, M., Masuda, Y., Denbow, D. M., & Furuse, M. (2001). Relationships between feeding and locomotion behaviors after central administration of CRF in chicks: Physiology & Behavior Vol 72(1-2) Jan 2001, 287-289.
  • Ojima, K., Matsumoto, K., Tohda, M., & Watanabe, H. (1995). Hyperactivity of central noradrenergic and CRF systems is involved in social isolation-induced decrease in pentobarbital sleep: Brain Research Vol 684(1) Jun 1995, 87-94.
  • O'Keane, V., Dinan, T. G., Scott, L., & Corcoran, C. (2005). Changes in hypothalamic-pituitary-adrenal axis measures after vagus nerve stimulation therapy in chronic depression: Biological Psychiatry Vol 58(12) Dec 2005, 963-968.
  • Okuyama, S., Chaki, S., Kawashima, N., Suzuki, Y., Ogawa, S.-I., Nakazato, A., et al. (1999). Receptor binding, behavioral and electrophysiological profiles of nonpeptide corticotropin-releasing factor subtype 1 receptor antagonists CRA1000 and CRA1001: Journal of Pharmacology and Experimental Therapeutics Vol 289(2) May 1999, 926-935.
  • Olive, M. F., Koenig, H. N., Nannini, M. A., & Hodge, C. W. (2002). Elevated extracellular CRF levels in the bed nucleus of the stria terminalis during ethanol withdrawal and reduction by subsequent ethanol intake: Pharmacology, Biochemistry and Behavior Vol 72(1-2) May 2002, 213-220.
  • Olive, M. F., Mehmert, K. K., Koenig, H. N., Camarini, R., Kim, J. A., Nannini, M. A., et al. (2003). A role for corticotropin releasing factor (CRF) in ethanol consumption, sensitivity, and reward as revealed by CRF-deficient mice: Psychopharmacology Vol 165(2) Jan 2003, 181-187.
  • Onaka, T., Kuramochi, M., Saito, J., Ueta, Y., & Yada, T. (2005). Galanin-like peptide stimulates vasopressin, oxytocin and adrenocorticotropic hormone release in rats: Neuroreport: For Rapid Communication of Neuroscience Research Vol 16(3) Feb 2005, 243-247.
  • Oohara, M., Negishi, M., Shimizu, H., Sato, N., & et al. (1993). !a-Melanocyte stimulating hormone (MSH) antagonizes the anorexia by corticotropin releasing factor (CRF): Life Sciences Vol 53(19) 1993, 1473-1477.
  • Opp, M. R. (1997). Rat strain differences suggest a role for corticotropin-releasing hormone in modulating sleep: Physiology & Behavior Vol 63(1) Dec 1997, 67-74.
  • Oshima, A., Flachskamm, C., Reul, J. M. H. M., Holsboer, F., & Linthorst, A. C. E. (2003). Altered Serotonergic Neurotransmission but Normal Hypothalamic-Pituitary-Adrenocortical Axis Activity in Mice Chronically Treated with the Corticotropin-Releasing Hormone Receptor Type 1 Antagonist NBI 30775: Neuropsychopharmacology Vol 28(12) Dec 2003, 2148-2159.
  • Oshima, A., Miyano, H., Yamashita, S., Owashi, T., Suzuki, S., Sakano, Y., et al. (2001). Psychological, autonomic and neuroendocrine responses to acute stressors in the combined dexamethasone/CRH test: A study of healthy subjects: Journal of Psychiatric Research Vol 35(2) Mar-Apr 2001, 95-104.
  • Otagiri, A., Wakabayashi, I., & Shibasaki, T. (2000). Selective Corticotropin-Releasing Factor Type 1 Receptor Antagonist Blocks Conditioned Fear-Induced Release of Noradrenaline in the Hypothalamic Paraventricular Nucleus of Rats: Journal of Neuroendocrinology Vol 12(10) Oct 2000, 1022-1026.
  • O'Toole, S. M., Chiappelli, F., & Rubin, R. T. (1998). Plasma neopterin in major depression: Relationship to basal and stimulated pituitary-adrenal cortical axis function: Psychiatry Research Vol 79(1) Jun 1998, 21-29.
  • Otte, C., Lenoci, M., Metzler, T., Yehuda, R., Marmar, C. R., & Neylan, T. C. (2007). Effects of Metyrapone on Hypothalamic-Pituitary-Adrenal Axis and Sleep in Women with Post-Traumatic Stress Disorder: Biological Psychiatry Vol 61(8) Apr 2007, 952-956.
  • Overstreet, D. H., Knapp, D. J., & Breese, G. R. (2004). Modulation of multiple ethanol withdrawal-induced anxiety-like behavior by CRF and CRF-sub-1 receptors: Pharmacology, Biochemistry and Behavior Vol 77(2) Feb 2004, 405-413.
  • Owens, M. J., Vargas, M. A., & Nemeroff, C. B. (1993). The effects of alprazolam on corticotropin-releasing factor neurons in the rat brain: Implications for a role for CRF in the pathogenesis of anxiety disorders: Journal of Psychiatric Research Vol 27(Suppl 1) 1993, 209-220.
  • Palmer, A. A., Sharpe, A. L., Burkhart-Kasch, S., McKinnon, C. S., Coste, S. C., Stenzel-Poore, M. P., et al. (2004). Corticotropin-releasing factor overexpression decreases ethanol drinking and increases sensitivity to the sedative effects of ethanol: Psychopharmacology Vol 176(3-4) 2004, 386-397.
  • Pang, X., Alexacos, N., Letourneau, R., Seretakis, D., Gao, W., Boucher, W., et al. (1998). The selective norepinephrine reuptake inhibitor, LY368975, reduces food consumption in animal models of feeding: Journal of Pharmacology and Experimental Therapeutics Vol 287(1) Oct 1998, 122-127.
  • Park, S.-K., Choi, D.-I., Hwang, I.-K., An, S.-J., Suh, J.-G., Oh, Y.-S., et al. (2003). The differential expression of corticotropin releasing factor and its binding protein in the gerbil hippocampal complex following seizure: Neurochemistry International Vol 42(1) Jan 2003, 57-65.
  • Park, S.-W., Lee, S.-K., Kim, J.-M., Kang, H.-C., Yoon, J.-S., & Kim, Y.-H. (2007). Quetiapine regulates the stress-induced increase in corticotropin-releasing factor mRNA expression in the rat hypothalamus: Progress in Neuro-Psychopharmacology & Biological Psychiatry Vol 31(2) Mar 2007, 357-360.
  • Parker, K. J., Schatzberg, A. F., & Lyons, D. M. (2003). Neuroendocrine aspects of hypercortisolism in major depression: Hormones and Behavior Vol 43(1) Jan 2003, 60-66.
  • Parrott, R. F., & Vellucci, S. V. (2000). Behaviour of pigs given corticotrophin-releasing hormone in combination with flumazenil or diazepam: Pharmacology, Biochemistry and Behavior Vol 67(3) Nov 2000, 465-471.
  • Parrott, R. F., Vellucci, S. V., & Goode, J. A. (2000). Behavioral and hormonal effects of centrally injected 'anxiogenic" neuropeptides in growing pigs: Pharmacology, Biochemistry and Behavior Vol 65(1) Jan 2000, 123-129.
  • Pascual, J., & Heinrichs, S. C. (2007). Olfactory neophobia and seizure susceptibility phenotypes in an animal model of epilepsy are normalized by impairment of brain corticotropin releasing factor: Epilepsia Vol 48(4) Apr 2007, 827-833.
  • Peeters, P. J., Fierens, F. L. P., van den Wyngaert, I., Goehlmann, H. W., Swagemakers, S. M., Kass, S. U., et al. (2004). Gene expression profiles highlight adaptive brain mechanisms in corticotropin releasing factor overexpressing mice: Molecular Brain Research Vol 129(1-2) Oct 2004, 135-150.
  • Pelleymounter, M. A., Joppa, M., Carmouche, M., Cullen, M. J., Brown, B., Murphy, B., et al. (2000). Role of corticotropin-releasing factor (CRF) receptors in the anorexic syndrome induced by CRF: Journal of Pharmacology and Experimental Therapeutics Vol 293(3) Jun 2000, 799-806.
  • Pelleymounter, M. A., Joppa, M., Ling, N., & Foster, A. C. (2002). Pharmacological evidence supporting a role for central corticotropin-releasing factor-sub-2 receptors in behavioral, but not endocrine, response to environmental stress: Journal of Pharmacology and Experimental Therapeutics Vol 302(1) Jul 2002, 145-152.
  • Pelton, G. H., Lee, Y., & Davis, M. (1997). Repeated stress, like vasopressin, sensitizes the excitatory effects of corticotropin releasing factor on the acoustic startle reflex: Brain Research Vol 778(2) Dec 1997, 381-387.
  • Perez, H., Ruiz, S., Nunez, H., White, A., & Gotteland, M. (2007). Coerulear activation by CRH and its role in hypertension induced by prenatal malnutrition in the rat: International Journal of Neuroscience Vol 117(5) May 2007, 627-642.
  • Perez, L., & Lysle, D. T. (1995). Corticotropin-releasing hormone is involved in conditioned stimulus-induced reduction of natural killer cell activity but not in conditioned alterations in cytokine production or proliferation responses: Journal of Neuroimmunology Vol 63(1) Dec 1995, 1-8.
  • Petrovich, G. D., Scicli, A. P., Thompson, R. F., & Swanson, L. W. (2000). Associative fear conditioning of enkephalin mRNA levels in central amygdalar neurons: Behavioral Neuroscience Vol 114(4) Aug 2000, 681-686.
  • Pich, E. M., Lorang, M., Yeganeh, M., de Fonseca, F. R., & et al. (1995). Increase of extracellular corticotropin-releasing factor-like immunoreactivity levels in the amygdala of awake rats during restraint stress and ethanol withdrawal as measured by microdialysis: Journal of Neuroscience Vol 15(8) Aug 1995, 5439-5447.
  • Pinnock, S. B., & Herbert, J. (2001). Corticosterone differentially modulates expression of corticotropin releasing factor and arginine vasopressin mRNA in the hypothalamic paraventricular nucleus following either acute or repeated restraint stress: European Journal of Neuroscience Vol 13(3) Feb 2001, 576-584.
  • Pisarska, M., Mulchahey, J. J., Welge, J. A., Geracioti, T. D., Jr., & Kasckow, J. W. (2000). Age-related alterations in emotional behaviors and amygdalar corticotropin-releasing factor (CRF) and CRF-binding protein expression in aged Fischer 344 rats: Brain Research Vol 877(2) Sep 2000, 184-190.
  • Plotsky, P. M., Thrivikraman, K. V., Nemeroff, C. B., Caldji, C., Sharma, S., & Meaney, M. J. (2005). Long-term consequences of neonatal rearing on central corticotropin-releasing factor systems in adult male rat offspring: Neuropsychopharmacology Vol 30(12) Dec 2005, 2192-2204.
  • Poplawski, M. M., Boyadjieva, N., & Sarkar, D. K. (2005). Vasoactive Intestinal Peptide and Corticotropin-Releasing Hormone Increase beta -Endorphin Release and Proopiomelanocortin Messenger RNA Levels in Primary Cultures of Hypothalamic Cells: Effects of Acute and Chronic Ethanol Treatment: Alcoholism: Clinical and Experimental Research Vol 29(4) Apr 2005, 648-655.
  • Posener, J. A., Schildkraut, J. J., Williams, G. H., Gleason, R. E., & et al. (1994). Acute and delayed effects of corticotropin-releasing hormone on dopamine activity in man: Biological Psychiatry Vol 36(9) Nov 1994, 616-621.
  • Post, A., Ohl, F., Almeida, O. F. X., Binder, E. B., Rucker, M., Welt, S., et al. (2005). Identification of molecules potentially involved in mediating the in vivo actions of the corticotropin-releasing hormone receptor 1 antagonist, NBI30775 (R121919): Psychopharmacology Vol 180(1) Jun 2005, 150-158.
  • Pothoulakis, C., Castagliuolo, I., & Leeman, S. E. (1998). Neuroimmune mechanisms of intestinal responses to stress: Role of corticotropin-releasing factor and neurotensin. New York, NY: New York Academy of Sciences.
  • Price, M. L., Curtis, A. L., Kirby, L. G., Valentino, R. J., & Lucki, I. (1998). Effects of corticotropin-releasing factor on brain serotonergic activity: Neuropsychopharmacology Vol 18(6) Jun 1998, 492-502.
  • Price, M. L., Kirby, L. G., Valentino, R. J., & Lucki, I. (2002). Evidence for corticotropin-releasing factor regulation of serotonin in the lateral septum during acute swim stress: Adaptation produced by repeated swimming: Psychopharmacology Vol 162(4) Aug 2002, 406-414.
  • Price, M. L., & Lucki, I. (2001). Regulation of serotonin release in the lateral septum and striatum by corticotropin-releasing factor: Journal of Neuroscience Vol 21(8) 2001, 2833-2841.
  • Przekop, F., & Tomaszewska, D. (1996). Responses in the hypothalamic monoaminergic system activity in ewes to beta -endorphin, CRF and their antagonists: Acta Neurobiologiae Experimentalis Vol 56(3) 1996, 807-817.
  • Raadsheer, F. C., van Keerikhuize, J. J., Lucassen, P. J., Hoogendijk, W. J. G., & et al. (1995). Corticotropin-releasing hormone mRNA levels in the paraventricular nucleus of patients with Alzheimer's disease and depression: American Journal of Psychiatry Vol 152(9) Sep 1995, 1372-1376.
  • Radulovic, J., Ruhmann, A., Liepold, T., & Spiess, J. (1999). Modulation of learning and anxiety by corticotropin-releasing factor (CRF) and stress: Differential roles of CRF receptors 1 and 2: Journal of Neuroscience Vol 19(12) Jun 1999, 5016-5025.
  • Radulovic, M., Weber, C., & Spiess, J. (2000). The effect of acute immobilization stress on the abundance of corticotropin-releasing factor receptor in lymphoid organs: Journal of Neuroimmunology Vol 103(2) March 2000, 153-164.
  • Raff, H., Jacobson, L., & Cullinan, W. E. (2007). Augmented hypothalamic corticotrophin-releasing hormone mRNA and corticosterone response to stress in adult rats exposed to perinatal hypoxia: Journal of Neuroendocrinology Vol 19(11) Nov 2007, 907-912.
  • Rainnie, D. G., Bergeron, R., Sajdyk, T. J., Patil, M., Gehlert, D. R., & Shekhar, A. (2004). Corticotrophin Releasing Factor-Induced Synaptic Plasticity in the Amygdala Translates Stress into Emotional Disorders: Journal of Neuroscience Vol 24(14) Apr 2004, 3471-3479.
  • Rapallino, M. V., Cupello, A., Hyden, H., & Izvarina, N. L. (2001). Modulation by acute stress of chloride permeation across microdissected vestibular neurons membranes: Different results in two rabbit strains and CRF involvement: Brain Research Vol 890(2) Feb 2001, 255-260.
  • Ray, A., Henke, P. G., Gulati, K., & Sen, P. (1993). The amygdaloid complex, corticotropin releasing factor and stress-induced gastric ulcerogenesis in rats: Brain Research Vol 624(1-2) Oct 1993, 286-290.
  • Refojo, D., Echenique, C., Muller, M. B., Reul, J. M. H. M., Deussing, J. M., Wurst, W., et al. (2005). Corticotropin-releasing hormone activates ERK1/2 MAPK in specific brain areas: PNAS Proceedings of the National Academy of Sciences of the United States of America Vol 102(17) Apr 2005, 6183-6188.
  • Reul, J. M. H., Labeur, M. S., Wiegers, G. J., & Linthorst, A. C. E. (1998). Altered neuroimmunoendocrine communication during a condition of chronically increased brain corticotropin-releasing hormone drive. New York, NY: New York Academy of Sciences.
  • Richard, D. (1993). Involvement of corticotropin-releasing factor in the control of food intake and energy expenditure. New York, NY: New York Academy of Sciences.
  • Richardson, R. D., Boswell, T., Woods, S. C., & Wingfield, J. C. (2000). Intracerebroventricular corticotropin-releasing factor decreases food intake in white-crowned sparrows: Physiology & Behavior Vol 71(1-2) Oct 2000, 213-216.
  • Richter, R. M., Zorrilla, E. P., Basso, A. M., Koob, G. F., & Weiss, F. (2000). Altered amygdalar CRF release and increased anxiety-like behavior in Sardinian alcohol-preferring rats: A microdialysis and behavioral study: Alcoholism: Clinical and Experimental Research Vol 24(12) Dec 2000, 1765-1772.
  • Risbrough, V. B., Hauger, R. L., Pelleymounter, M. A., & Geyer, M. A. (2003). Role of corticotropin releasing factor (CRF) receptors 1 and 2 in CRF-potentiated acoustic startle in mice: Psychopharmacology Vol 170(2) Nov 2003, 178-187.
  • Risbrough, V. B., Hauger, R. L., Roberts, A. L., Vale, W. W., & Geyer, M. A. (2004). Corticotropin-Releasing Factor Receptors CRF-sub-1 and CRF-sub-2 Exert Both Additive and Opposing Influences on Defensive Startle Behavior: Journal of Neuroscience Vol 24(29) Jul 2004, 6545-6552.
  • Risbrough, V. B., & Stein, M. B. (2006). Role of corticotropin releasing factor in anxiety disorders: A translational research perspective: Hormones and Behavior Vol 50(4) Nov 2006, 550-561.
  • Ritchie, J. C. (1995). Studies on the metabolism of corticotropin-releasing factor. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Ritchie, J. C., Davis, T. P., & Nemeroff, C. B. (2003). Action of three ectopeptidases on corticotropin-releasing factor: Metabolism and functional aspects: Neuropsychopharmacology Vol 28(1) Jan 2003, 22-33.
  • Rivest, S., Laflamme, N., & Nappi, R. E. (1995). Immune challenge and immobilization stress induce transcription of the gene encoding the CRF receptor in selective nuclei of the rat hypothalamus: Journal of Neuroscience Vol 15(4) Apr 1995, 2680-2695.
  • Rivier, C., & Lee, S. (1996). Acute alcohol administration stimulates the activity of hypothalamic neurons that express corticotropin-releasing factor and vasopressin: Brain Research Vol 726(1-2) Jul 1996, 1-10.
  • Rodriguez de Fonesca, F., Carrera, M. R. A., Navarro, M., Koob, G. F., & et al. (1997). Activation of corticotropin-release factor in the limbic system during cannabinoid withdrawal: Science Vol 276(5321) Jun 1997, 2050-2054.
  • Rodriguez de Fonseca, F., Pilar, R., Menzaghi, F., Merlo-Pich, E., & et al. (1996). Corticotropin-releasing factor (CRF) antagonist: Journal of Pharmacology and Experimental Therapeutics Vol 276(1) Jan 1996, 56-64.
  • Romero, L. M. (1994). Patterns of ACTH secretagog release in response to psychological stress. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Romero, L. M., Levine, S., & Sapolsky, R. M. (1995). Patterns of adrenocorticotropin secretagog release in response to social interactions and various degrees of novelty: Psychoneuroendocrinology Vol 20(2) 1995, 183-191.
  • Ronsaville, D. S., Municchi, G., Laney, C., Cizza, G., Meyer, S. E., Haim, A., et al. (2006). Maternal and environmental factors influence the hypothalamic-pituitary-adrenal axis response to corticotropin-releasing hormone infusion in offspring of mothers with or without mood disorders: Development and Psychopathology Vol 18(1) Win 2006, 173-194.
  • Rosenberger, P., Muhlbauer, E., Weissmuller, T., Rommelspacher, H., Sinha, P., Wernecke, K. D., et al. (2003). Decreased proopiomelanocortin mRNA in lymphocytes of chronic alcoholics after intravenous human corticotropin releasing factor injection: Alcoholism: Clinical and Experimental Research Vol 27(11) Nov 2003, 1693-1700.
  • Rosenblum, L. A., Smith, E. L. P., Altemus, M., Scharf, B. A., Owens, M. J., Nemeroff, C. B., et al. (2002). Differing concentrations of corticotropin-releasing factor and oxytocin in the cerebrospinal fluid of bonnet and pigtail macaques: Psychoneuroendocrinology Vol 27(6) Aug 2002, 651-660.
  • Roy, A., Bissette, G., Williams, R., Berman, J., & Gonzalez, B. (2003). CSF CRH in abstinent cocaine-dependent patients: Psychiatry Research Vol 117(3) Mar 2003, 277-280.
  • Rubinow, D. R., Roca, C. A., Schmidt, P. J., Danaceau, M. A., Putnam, K., Cizza, G., et al. (2005). Testosterone suppression of CRH-stimulated cortisol in men: Neuropsychopharmacology Vol 30(10) Oct 2005, 1906-1912.
  • Ruhmann, A., Chapman, J., Higelin, J., Butscha, B., & Dautzenberg, F. M. (2002). Design, synthesis and pharmacological characterization of new highly selective CRF-sub-2 antagonists: Development of superscript 1superscript 2superscript 3I-K31440 as a potential SPECT ligand: Peptides Vol 23(3) Mar 2002, 453-460.
  • Rupprecht, M., Hornstein, O. P., Schluter, D., Schafers, H.-J., & et al. (1995). Cortisol, corticotropin, and !b-endorphin responses to corticotropin-releasing hormone in patients with atopic eczema: Psychoneuroendocrinology Vol 20(5) 1995, 543-551.
  • Rybakowski, J. K., & Twardowska, K. (1999). The dexamethasone/corticotropin-releasing hormone test in depression in bipolar and unipolar affective illness: Journal of Psychiatric Research Vol 33(5) Sep-Oct 1999, 363-370.
  • Saavedra, J. M., Armando, I., Bregonzio, C., Juorio, A., Macova, M., Pavel, J., et al. (2006). A Centrally Acting, Anxiolytic Angiotensin II AT-sub-1 Receptor Antagonist Prevents the Isolation Stress-Induced Decrease in Cortical CRF-sub-1 Receptor and Benzodiazepine Binding: Neuropsychopharmacology Vol 31(6) Jun 2006, 1123-1134.
  • Sabino, V., Cottone, P., Koob, G. F., Steardo, L., Lee, M. J., Rice, K. C., et al. (2006). Dissociation between opioid and CRF-sub-1 antagonist sensitive drinking in Sardinian alcohol-preferring rats: Psychopharmacology Vol 189(2) Dec 2006, 175-186.
  • Sahuque, L. L., Kullberg, E. F., McGeehan, A. J., Kinder, J. R., Hicks, M. P., Blanton, M. G., et al. (2006). Anxiogenic and aversive effects of corticotropin-releasing factor (CRF) in the bed nucleus of the stria terminaiis in the rat: Role of CRF receptor subtypes: Psychopharmacology Vol 186(1) May 2006, 122-132.
  • Sajdyk, T. J., Fitz, S. D., & Shekhar, A. (2006). The role of neuropeptide Y in the amygdala on corticotropin-releasing factor receptor-mediated behavioral stress responses in the rat: Stress: The International Journal on the Biology of Stress Vol 9(1) Mar 2006, 21-28.
  • Sajdyk, T. J., Schober, D. A., Gehlert, D. R., & Shekhar, A. (1999). Role of corticotropin-releasing factor and urocortin within the basolateral amygdala of rats in anxiety and panic responses: Behavioural Brain Research Vol 100(1-2) Apr 1999, 207-215.
  • Salak-Johnson, J. L., Anderson, D. L., & McGlone, J. J. (2004). Differential dose effects of central CRF and effects of CRF astressin on pig behavior: Physiology & Behavior Vol 83(1) Oct 2004, 143-150.
  • Salak-Johnson, J. L., McGlone, J. J., Whisnant, C. S., Norman, R. L., & Kraeling, R. R. (1997). Intracerebroventricular porcine corticotropin-releasing hormone and cortisol effects on pig immune measures and behavior: Physiology & Behavior Vol 61(1) Jan 1997, 15-23.
  • Sananbenesi, F., Fischer, A., Schrick, C., Spiess, J., & Radulovic, J. (2003). Mitogen-Activated Protein Kinase Signaling in the Hippocampus and Its Modulation by Corticotropin- Releasing Factor Receptor 2: A Possible Link between Stress and Fear Memory: Journal of Neuroscience Vol 23(36) Dec 2003, 11436-11443.
  • Sandman, C. A., Wadhwa, P. D., Chicz-DeMet, A., Porto, M., & Garite, T. J. (1999). Maternal corticotropin-releasing hormone and habituation in the human fetus: Developmental Psychobiology Vol 34(3) Apr 1999, 163-173.
  • Sarkar, S., Fekete, C., Legradi, G., & Lechan, R. M. (2003). Glucagon like peptide-1 (7-36) amide (GLP-1) nerve terminals densely innervate corticotropin-releasing hormone neurons in the hypothalamic paraventricular nucleus: Brain Research Vol 985(2) Sep 2003, 163-168.
  • Sarnyai, Z. (1998). Neurobiology of stress and cocaine addiction: Studies on corticotropin-releasing factor in rats, monkeys, and humans. New York, NY: New York Academy of Sciences.
  • Sarnyai, Z., Biro, E., Gardi, J., Vecsernyes, M., & et al. (1995). Brain corticotropin-releasing factor mediates "anxiety-like" behavior induced by cocaine withdrawal in rats: Brain Research Vol 675(1-2) Mar 1995, 89-97.
  • Sautter, F. J., Bissette, G., Wiley, J., Manguno-Mire, G., Schoenbachler, B., Myers, L., et al. (2003). Corticotropin-releasing factor in posttraumatic stress disorder (PTSD) with secondary psychotic symptoms, nonpsychotic PTSD, and healthy control subjects: Biological Psychiatry Vol 54(12) Dec 2003, 1382-1388.
  • Sawada, K., Kawano, M., Tsuji, H., Sakata-Haga, H., Hisano, S., & Fukui, Y. (2003). Over-expression of corticotropin-releasing factor mRNA in inferior olivary neurons of rolling mouse Nagoya: Molecular Brain Research Vol 117(2) Oct 2003, 190-195.
  • Schiml, P. A., & Rissman, E. F. (2000). Effects of gonadotropin-releasing hormones, corticotropin-releasing hormone, and vasopressin on female sexual behavior: Hormones and Behavior Vol 37(3) May 2000, 212-220.
  • Schluger, J. H., Bart, G., Green, M., Ho, A., & Kreek, M. J. (2003). Corticotropin-releasing factor testing reveals a dose-dependent difference in methadone maintained vs control subjects: Neuropsychopharmacology Vol 28(5) May 2003, 985-994.
  • Schmeelk, K. H., Granger, D. A., Susman, E. J., & Chrousos, G. P. (1999). Maternal depression and risk for postpartum complications: Role of prenatal corticotropin-releasing hormone and interleukin-1 receptor antagonist: Behavioral Medicine Vol 25(2) Sum 1999, 88-93.
  • Schmider, J., Lammers, C.-H., Gotthardt, U., Dettling, M., Holsboer, F., & Heuser, I. J. E. (1995). Combined dexamethasone/corticopin-releasing hormone test in acute and remitted manic patients, in acute depression, and in normal controls: I: Biological Psychiatry Vol 38(12) Dec 1995, 797-802.
  • Schmidt-Reinwald, A., Pruessner, J. C., Hellhammer, D. H., Federenko, I., Rohleder, N., Schurmeyer, T. H., et al. (1999). The cortisol response to awakening in relation to different challenge tests and a 12-hour cortisol rhythm: Life Sciences Vol 64(18) Mar 1999, 1653-1660.
  • Schulkin, J. (1994). Melancholic depression and the hormones of adversity: A role for the amygdala: Current Directions in Psychological Science Vol 3(2) Apr 1994, 41-44.
  • Schulkin, J., Gold, P. W., & McEwen, B. S. (1998). Induction of corticotropin-releasing hormone gene expression by glucocorticoids: Implication for understanding the states of fear and anxiety and allostatic load: Psychoneuroendocrinology Vol 23(3) Apr 1998, 219-243.
  • Schulkin, J., McEwen, B. S., & Gold, P. W. (1994). Allostasis, amygdala, and anticipatory angst: Neuroscience & Biobehavioral Reviews Vol 18(3) Fal 1994, 385-396.
  • Schulkin, J., Morgan, M. A., & Rosen, J. B. (2005). A neuroendocrine mechanism for sustaining fear: Trends in Neurosciences Vol 28(12) Dec 2005, 629-635.
  • Schulz, C., Christodulopulu, E., Bock, A., Kretz, M., & et al. (1994). Effects of thyrotropin- and corticotropin-releasing hormone on blood pressure and plasma catecholamines in the anesthetized rat: Neuropsychobiology Vol 30(4) 1994, 178-184.
  • Scott, L. V., & Dinan, T. G. (2002). Vasopressin as a target for antidepressant development: An assessment of the available evidence: Journal of Affective Disorders Vol 72(2) Nov 2002, 113-124.
  • Scott, L. V., Medbak, S., & Dinan, T. G. (1999). Desmopressin augments pituitary-adrenal responsivity to corticotropin-releasing hormone in subjects with chronic fatigue syndrome and in healthy volunteers: Biological Psychiatry Vol 45(11) Jun 1999, 1447-1454.
  • Seifritz, E., Klemfuss, H., Montes, J. M., Britton, K. T., & Ehlers, C. L. (1998). Effects of corticotropin-releasing factor on circadian locomotor rhythm in the golden hamster: Pharmacology, Biochemistry and Behavior Vol 60(4) Aug 1998, 855-862.
  • Sekino, A., Ohata, H., Mano-Otagiri, A., Arai, K., & Shibasaki, T. (2004). Both corticotropin-releasing factor receptor type 1 and type 2 are involved in stress-induced inhibition of food intake in rats: Psychopharmacology Vol 176(1) Oct 2004, 30-38.
  • Serra, M., Concas, A., Mostallino, M. C., Chessa, M. F., Stomati, M., Petraglia, F., et al. (1999). Antagonism by pivagabine of stress-induced changes in GABA-sub(A ) receptor function and corticotropin-releasing factor concentrations in rat brain: Psychoneuroendocrinology Vol 24(3) Apr 1999, 269-284.
  • Serra, M., Pisu, M. G., Floris, I., & Biggio, G. (2005). Social isolation-induced changes in the hypothalamic-pituitary-adrenal axis in the rat: Stress: The International Journal on the Biology of Stress Vol 8(4) Dec 2005, 259-264.
  • Servatius, R. J., Beck, K. D., Moldow, R. L., Salameh, G., Tumminello, T. P., & Short, K. R. (2005). A Stress-Induced Anxious State in Male Rats: Corticotropin-Releasing Hormone Induces Persistent Changes in Associative Learning and Startle Reactivity: Biological Psychiatry Vol 57(8) Apr 2005, 865-872.
  • Seymour, P. A., Schmidt, A. W., & Schulz, D. W. (2003). The Pharmacology of CP-154,526, a Non-Peptide Antagonist of the CRH1 Receptor: A Review: CNS Drug Reviews Vol 9(1) Spr 2003, 57-96.
  • Shaham, Y., Erb, S., Leung, S., Buczek, Y., & Stewart, J. (1998). CP-154,526, a selective, non-peptide antagonist of the corticotropin-releasing factor-sub-1 receptor attenuates stress-induced relapse to drug seeking in cocaine- and heroin-trained rats: Psychopharmacology Vol 137(2) May 1998, 184-190.
  • Shaham, Y., Funk, D., Erb, S., & Brown, T. J. (1997). Corticotropin-releasing factor, but not corticosterone, is involved in stress-induced relapse to heroin-seeking in rats: Journal of Neuroscience Vol 17(7) Apr 1997, 2605-2614.
  • Shalev, U., Finnie, P. S., Quinn, T., Tobin, S., & Wahi, P. (2006). A role for corticotropin-releasing factor, but not corticosterone, in acute food-deprivation-induced reinstatement of heroin seeking in rats: Psychopharmacology Vol 187(3) Aug 2006, 376-384.
  • Shalev, U., Morales, M., Hope, B., Yap, J., & Shaham, Y. (2001). Time-dependent changes in extinction behavior and stress-induced reinstatement of drug seeking following withdrawal from heroin in rats: Psychopharmacology Vol 156(1) 2001, 98-107.
  • Shalyapina, V. G., Rakitskaya, V. V., Petrova, E. I., & Mironova, V. I. (2004). Adaptive Behavior in Active and Passive Rats after Intranasal Administration of Corticotrophin-Releasing Hormone: Neuroscience and Behavioral Physiology Vol 34(2) Feb 2004, 193-197.
  • Sharpe, A. L., Coste, S. C., Burkhart-Kasch, S., Li, N., Stenzel-Poore, M. P., & Phillips, T. J. (2005). Mice deficient in corticotropin-releasing factor receptor type 2 exhibit normal ethanol-associated behaviors: Alcoholism: Clinical and Experimental Research Vol 29(9) Sep 2005, 1601-1609.
  • Shekhar, A., Truitt, W., Rainnie, D., & Sajdyk, T. (2005). Role of stress, corticotrophin releasing factor (CRF) and amygdala plasticity in chronic anxiety: Stress: The International Journal on the Biology of Stress Vol 8(4) Dec 2005, 209-219.
  • Shepard, J. D. (2001). Effects of elevated glucocorticoids in the amygdala on behavioral and neuroendocrine components of the stress response. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Shepard, J. D., Barron, K. W., & Myers, D. A. (2000). Corticosterone delivery to the amygdala increases corticotropin-releasing factor mRNA in the central amygdaloid nucleus and anxiety-like behavior: Brain Research Vol 861(2) Apr 2000, 288-295.
  • Shepard, J. D., Schulkin, J., & Myers, D. A. (2006). Chronically elevated corticosterone in the amygdala increases corticotropin releasing factor mRNA in the dorsolateral bed nucleus of stria terminalis following duress: Behavioural Brain Research Vol 174(1) Nov 2006, 193-196.
  • Shibasaki, T., Imaki, T., Hotta, M., Ling, N., & et al. (1993). Psychological stress increases arousal through brain corticotropin-releasing hormone without significant increase in adrenocorticotropin and catecholamine secretion: Brain Research Vol 618(1) Jul 1993, 71-75.
  • Shimakura, S.-I., Miura, T., Maruyama, K., Nakamachi, T., Uchiyama, M., Kageyama, H., et al. (2008). alpha -Melanocyte-stimulating hormone mediates melanin-concentrating hormone-induced anorexigenic action in goldfish: Hormones and Behavior Vol 53(2) Feb 2008, 323-328.
  • Sillaber, I., Rammes, G., Zimmermann, S., Mahal, B., Zieglgansberger, W., Wurst, W., et al. (2002). Enhanced and delayed stress-induced alcohol drinking in mice lacking functional CRH1 receptors: Science Vol 296(5569) May 2002, 931-933.
  • Sinniger, V., Porcher, C., Mouchet, P., Juhem, A., & Bonaz, B. (2004). c-fos and CRF receptor gene transcription in the brain of acetic acid-induced somato-visceral pain in rats: Pain Vol 110(3) Aug 2004, 738-750.
  • Skelton, K. H., Gutman, D. A., Thrivikraman, K. V., Nemeroff, C. B., & Owens, M. J. (2007). The CRF-sub-1 receptor antagonist R121919 attenuates the neuroendocrine and behavioral effects of precipitated lorazepam withdrawal: Psychopharmacology Vol 192(3) Jun 2007, 385-396.
  • Skelton, K. H., Nemeroff, C. B., Knight, D. L., & Owens, M. J. (2000). Chronic administration of the triazolobenzodiazepine alprazolam produces opposite effects on corticotropin-releasing factor and urocortin neuronal systems: Journal of Neuroscience Vol 20(3) Feb 2000, 1240-1248.
  • Skelton, K. H., Nemeroff, C. B., & Owens, M. J. (2004). Spontaneous Withdrawal from the Triazolobenzodiazepine Alprazolam Increases Cortical Corticotropin-Releasing Factor mRNA Expression: Journal of Neuroscience Vol 24(42) 2004, 9303-9312.
  • Skutella, T., Criswell, H., Moy, S., Probst, J. C., & et al. (1994). Corticotropin-releasing hormone (CRH) antisense oligodeoxynucleotide induces anxiolytic effects in rat: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 5(16) Oct 1994, 2181-2185.
  • Smagin, G. N., & Goeders, N. E. (2004). Effects of acute and chronic ketoconazole administration on hypothalamo-pituitary-adrenal axis activity and brain corticotropin-releasing hormone: Psychoneuroendocrinology Vol 29(10) Nov 2004, 1223-1228.
  • Smagin, G. N., Heinrichs, S. C., & Dunn, A. J. (2001). The role of CRH in behavioral responses to stress: Peptides Vol 22(5) May 2001, 713-724.
  • Smagin, G. N., Howell, L. A., Ryan, D. H., De Souza, E. B., & Harris, R. B. S. (1998). The role of CRF-sub-2 receptors in corticotropin-releasing factor- and urocortin-induced anorexia: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 9(7) May 1998, 1601-1606.
  • Smoller, J. W., Rosenbaum, J. F., Biederman, J., Kennedy, J., Dai, D., Racette, S. R., et al. (2003). Association of a genetic marker at the corticotropin-releasing hormone locus with behavioral inhibition: Biological Psychiatry Vol 54(12) Dec 2003, 1376-1381.
  • Smoller, J. W., Yamaki, L. H., Fagerness, J. A., Biederman, J., Racette, S., Laird, N. M., et al. (2005). The Corticotropin-Releasing Hormone Gene and Behavioral Inhibition in Children at Risk for Panic Disorder: Biological Psychiatry Vol 57(12) Jun 2005, 1485-1492.
  • Smythe, J. W., McCormick, C. M., & Meaney, M. J. (1996). Median eminence corticotrophin-releasing hormone content following prenatal stress and neonatal handling: Brain Research Bulletin Vol 40(3) 1996, 195-199.
  • Sommer, W. H., Rimondini, R., Hansson, A. C., Hipskind, P. A., Gehlert, D. R., Barr, C. S., et al. (2008). Upregulation of voluntary alcohol intake, behavioral sensitivity to stress, and amygdala Crhr1 expression following a history of dependence: Biological Psychiatry Vol 63(2) Jan 2008, 139-145.
  • Spina, M., Merlo-Pich, E., Chan, R. K. W., & Basso, A. M. (1996). Appetite-suppressing effects of urocortin, A CRF-related neuropeptide: Science Vol 273(5281) Sep 1996, 1561-1564.
  • Spina, M. G., Basso, A. M., Zorrilla, E. P., Heyser, C. J., Rivier, J., Vale, W., et al. (2000). Behavioral effects of central administration of the novel CRF antagonist astressin in rats: Neuropsychopharmacology Vol 22(3) Mar 2000, 230-239.
  • Spina, M. G., Merlo-Pich, E., Akwa, Y., Balducci, C., Basso, A. M., Zorrilla, E. P., et al. (2002). Time-dependent induction of anxiogenic-like effects after central infusion of urocortin or corticotropin-releasing factor in the rat: Psychopharmacology Vol 160(2) Mar 2002, 113-121.
  • Steckler, T., & Holsboer, F. (1999). Corticotropin-releasing hormone receptor subtypes and emotion: Biological Psychiatry Vol 46(11) Dec 1999, 1480-1508.
  • Steckler, T., & Holsboer, F. (2001). Interaction between the cholinergic system and CRH in the modulation of spatial discrimination learning in mice: Brain Research Vol 906(1-2) Jul 2001, 46-59.
  • Stiedl, O., & Meyer, M. (2002). Fractal dynamics of heart beat interval fluctuations in corticotropin-releasing factor receptor subtype 2 deficient mice: Integrative Physiological & Behavioral Science Vol 37(4) Oct-Dec 2002, 311-345.
  • Stiedl, O., Meyer, M., Jahn, O., Ogren, S. O., & Spiess, J. (2005). Corticotropin-Releasing Factor Receptor 1 and Central Heart Rate Regulation in Mice during Expression of Conditioned Fear: Journal of Pharmacology and Experimental Therapeutics Vol 312(3) Mar 2005, 905-916.
  • Stinus, L., Cador, M., Zorrilla, E. P., & Koob, G. F. (2005). Buprenorphine and a CRF-sub-1 Antagonist Block the Acquisition of Opiate Withdrawal-Induced Conditioned Place Aversion in Rats: Neuropsychopharmacology Vol 30(1) Jan 2005, 90-98.
  • Stout, S. C., Owens, M. J., Lindsey, K. P., Knight, D. L., & Nemeroff, C. B. (2001). Effects of sodium valproate on corticotropin-releasing factor systems in rat brain: Neuropsychopharmacology Vol 24(6) Jun 2001, 624-631.
  • Stout, S. C., Owens, M. J., & Nemeroff, C. B. (2002). Regulation of corticotropin-releasing factor neuronal systems and hypothalamic-pituitary-adrenal axis activity by stress and chronic antidepressant treatment: Journal of Pharmacology and Experimental Therapeutics Vol 300(3) Mar 2002, 1085-1092.
  • Strange, L. B. (2004). Sleep patterns of women at risk for the development of preterm labor. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Strohle, A., Kellner, M., Holsboer, F., & Wiedemann, K. (1998). Atrial natriuretic hormone decreases endocrine response to a combined dexamethasone-corticotropin-releasing hormone test: Biological Psychiatry Vol 43(5) Mar 1998, 371-375.
  • Stroud, L. R., Papandonatos, G. D., Williamson, D. E., & Dahl, R. E. (2004). Applying a Nonlinear Regression Model to Characterize Cortisol Responses to Corticotropin-Releasing Hormone Challenge. New York, NY: New York Academy of Sciences.
  • Suarez, M. M., Rivarola, M. A., Molina, S. M., Perassi, N. I., Levin, G. M., & Cabrera, R. (2001). Periodic maternal deprivation and lesion of anterodorsal thalami nuclei induce alteration on hypophyso adrenal system activity in adult rats: Life Sciences Vol 69(7) Jul 2001, 803-813.
  • Summers, C. H., Kampshoff, J. L., Ronan, P. J., Lowry, C. A., Prestbo, A. A., Korzan, W. J., et al. (2003). Monoaminergic Activity in Subregions of Raphe Nuclei Elicited by Prior Stress and the Neuropeptide Corticotropin-Releasing Factor: Journal of Neuroendocrinology Vol 15(12) Dec 2003, 1122-1133.
  • Swiergiel, A. H. (2003). Effects of infusion of corticotropin-releasing factor antagonist into the locus coeruleus on freezing behavior and brain catecholamines in rats: Acta Neurobiologiae Experimentalis Vol 63(1) 2003, 9-16.
  • Swiergiel, A. H., & Dunn, A. J. (1999). CRF-deficient mice respond like wild-type mice to hypophagic stimuli: Pharmacology, Biochemistry and Behavior Vol 64(1) Sep 1999, 59-64.
  • Swiergiel, A. H., Takahashi, L. K., & Kalin, N. H. (1993). Attenuation of stress-induced behavior by antagonism of corticotropin-releasing factor receptors in the central amygdala in the rat: Brain Research Vol 623(2) Oct 1993, 229-234.
  • Swinny, J. D., Kalicharan, D., Blaauw, E. H., Ijkema-Paassen, J., Shi, F., Gramsbergen, A., et al. (2003). Corticotropin-releasing factor receptor types 1 and 2 are differentially expressed in pre- and post-synaptic elements in the post-natal developing rat cerebellum: European Journal of Neuroscience Vol 18(3) Aug 2003, 549-562.
  • Tache, Y., & Rivier, C. (1993). Corticotropin-releasing factor and cytokines: Role in the stress response. New York, NY: New York Academy of Sciences.
  • Tachibana, T., Takahashi, H., Oikawa, D., Denbow, D. M., & Furuse, M. (2006). Thyrotropin-releasing hormone increased heat production without the involvement of corticotropin-releasing factor in neonatal chicks: Pharmacology, Biochemistry and Behavior Vol 83(4) Apr 2006, 528-532.
  • Takahashi, L. K. (2001). Role of CRF-sub-1 and CRF-sub-2 receptors in fear and anxiety: Neuroscience & Biobehavioral Reviews Vol 25(7-8) Dec 2001, 627-636.
  • Takahashi, L. K., Ho, S. P., Livanov, V., Graciani, N., & Arneric, S. P. (2001). Antagonism of CRF-sub-2 receptors produces anxiolytic behavior in animal models of anxiety: Brain Research Vol 902(2) Jun 2001, 135-142.
  • Takamori, K., Kawashima, N., Chaki, S., Nakazato, A., & Kameo, K. (2001). Involvement of corticotropin-releasing factor subtype 1 receptor in the acquisition phase of learned helplessness in rats: Life Sciences Vol 69(11) Aug 2001, 1241-1248.
  • Takamori, K., Kawashima, N., Chaki, S., Nakazato, A., & Kameo, K. (2001). Involvement of the hypothalamus-pituitary-adrenal axis in antidepressant activity of corticotropin-releasing factor subtype 1 receptor antagonists in the rat learned helplessness test: Pharmacology, Biochemistry and Behavior Vol 69(3-4) Jul-Aug 2001, 445-449.
  • Takao, T., Hashimoto, K., & De Souza, E. B. (1995). Modulation of interleukin-1 receptors in the brain-endocrine-immune axis by stress and infection: Brain, Behavior, and Immunity Vol 9(4) Dec 1995, 276-291.
  • Tan, H., Zhong, P., & Yan, Z. (2004). Corticotropin-Releasing Factor and Acute Stress Prolongs Serotonergic Regulation of GABA Transmission in Prefrontal Cortical Pyramidal Neurons: Journal of Neuroscience Vol 24(21) May 2004, 5000-5008.
  • Tan, L. A., Xu, K., Vaccarino, F. J., Lovejoy, D. A., & Rotzinger, S. (2008). Repeated intracerebral teneurin C-terminal associated peptide (TCAP)-1 injections produce enduring changes in behavioral responses to corticotropin-releasing factor (CRF) in rat models of anxiety: Behavioural Brain Research Vol 188(1) 2008, 195-200.
  • Tao, J., Zhang, Y., Soong, T. W., & Li, S. (2006). Expression of Urocortin 2 and its Inhibitory Effects on Intracellular Ca-super(2+) Via L-Type Voltage-Gated Calcium Channels in Rat Pheochromocytoma (PC 12) Cells: Neuropsychopharmacology Vol 31(12) Dec 2006, 2600-2609.
  • Te Brugge, V. A., Nassel, D. R., Coast, G. M., Schooley, D. A., & Orchard, I. (2001). The distribution of a kinin-like peptide and its co-localization with a CRF-like peptide in the blood-feeding bug, Rhodnius prolixus: Peptides Vol 22(2) Feb 2001, 161-173.
  • Tellam, D. J., Perone, M. J., Dunn, I. C., Radovick, S., Brennand, J., Rivier, J. E., et al. (1998). Direct regulation of GnRH transcription by CRF-like peptides in an immortalized neuronal cell line: Neuroreport: An International Journal for the Rapid Communication of Research in Neuroscience Vol 9(14) Oct 1998, 3135-3140.
  • Terawaki, K., Koike, K., Yuzurihara, M., Kase, Y., Takeda, S., Aburada, M., et al. (2004). Effects of the traditional Japanese medicine Unkei-to on the corticotropin-releasing factor-induced increase in locomotor activity: Pharmacology, Biochemistry and Behavior Vol 78(4) Aug 2004, 799-803.
  • Terawaki, K., Koike, K., Yuzurihara, M., Kurauchi, K., Ishige, A., Sasaki, H., et al. (2001). An inhibitory effect of cytokine-induced neurotrophil chemoattractant on cortiocotropin-releasing factor-induced increase in locomotor activity: Brain Research Vol 917(1) Oct 2001, 133-137.
  • Tershner, S. A., & Helmstetter, F. J. (1996). Injections of corticotropin-releasing factor into the periaqueductal gray enhance Pavlovian fear conditioning: Psychobiology Vol 24(1) Mar 1996, 49-56.
  • Thalen, B. E., Kjellman, B. F., Ljunggren, J. G., Akner, G., & et al. (1993). Release of corticotropin after administration of corticotropin-releasing hormone in depressed patients in relation to the dexamethasone suppression test: Acta Psychiatrica Scandinavica Vol 87(2) Feb 1993, 133-140.
  • Thomas, L. A., & De Bellis, M. D. (2004). Pituitary volumes in pediatric maltreatment-related posttraumatic stress disorder: Biological Psychiatry Vol 55(7) Apr 2004, 752-758.
  • Thompson, B. L., Erickson, K., Schulkin, J., & Rosen, J. B. (2004). Corticosterone facilitates retention of contextually conditioned fear and increases CRH mRNA expression in the amygdala: Behavioural Brain Research Vol 149(2) 2004, 209-215.
  • Thorsell, A., Slawecki, C. J., & Ehlers, C. L. (2005). Effects of neuropeptide Y and corticotropin-releasing factor on ethanol intake in Wistar rats: Interaction with chronic ethanol exposure: Behavioural Brain Research Vol 161(1) Jun 2005, 133-140.
  • Tilders, F. J. H., & Schmidt, E. D. (1998). Interleukin-1-induced plasticity of hypothalamic CRH neurons and long-term stress hyperresponsiveness. New York, NY: New York Academy of Sciences.
  • To, C. T., Anheuer, Z. E., & Bagdy, G. (1999). Effects of acute and chronic fluoxetine treatment on CRH-induced anxiety: Neuroreport: For Rapid Communication of Neuroscience Research Vol 10(3) Feb 1999, 553-555.
  • Tobin, J. P. (2001). Post traumatic stress disorder and the adrenal gland: Irish Journal of Psychological Medicine Vol 18(1) Mar 2001, 27-29.
  • Todorovic, C., Jahn, O., Tezval, H., Hippel, C., & Spiess, J. (2005). The role of CRF receptors in anxiety and depression: Implications of the novel CRF-sub-1 agonist cortagine: Neuroscience & Biobehavioral Reviews Vol 29(8) Dec 2005, 1323-1333.
  • Toufexis, D. J., Davis, C., Hammond, A., & Davis, M. (2004). Progesterone Attenuates Corticotropin-Releasing Factor-Enhanced But Not Fear-Potentiated Startle via the Activity of Its Neuroactive Metabolite, Allopregnanolone: Journal of Neuroscience Vol 24(45) 2004, 10280-10287.
  • Toufexis, D. J., Myers, K. M., & Davis, M. (2006). The effect of gonadal hormones and gender on anxiety and emotional learning: Hormones and Behavior Vol 50(4) Nov 2006, 539-549.
  • Treutlein, J., Kissling, C., Frank, J., Wiemann, S., Dong, L., Depner, M., et al. (2006). Genetic association of the human corticotropin releasing hormone receptor 1 (CRHR1) with binge drinking and alcohol intake patterns in two independent samples: Molecular Psychiatry Vol 11(6) Jun 2006, 594-602.
  • Tringali, G., Aubry, J. M., Moscianese, K., Zamori, C., Vairano, M., Preziosi, P., et al. (2004). Valproic acid inhibits corticotropin-releasing factor synthesis and release from the rat hypothalamus in vitro: Evidence for the involvement of GABAergic neurotransmission: Journal of Psychiatry & Neuroscience Vol 29(6) Nov 2004, 459-466.
  • Tringali, G., Aubry, J. M., Navarra, P., & Pozzoli, G. (2006). Lamotrigine inhibits basal and Na-super(+)-stimulated, but not Ca-super(2+)-stimulated, release of corticotropin-releasing hormone from the rat hypothalamus: Psychopharmacology Vol 188(3) Oct 2006, 386-392.
  • Tucci, S., Cheeta, S., Seth, P., & File, S. E. (2003). Corticotropin releasing factor antagonist,alpha -helical CRF-sub(9-41), reverses nictoine-induced conditioned, but not unconditioned, anxiety: Psychopharmacology Vol 167(3) May 2003, 251-256.
  • Turkina, E. V., Rybnikova, E. A., Rakitskaya, V. V., & Shaliapina, V. G. (1997). Alteration of behavioural components of stress with intrastriatal administration of corticoliberine: Rossiyskiy Fiziologicheskiy Zhurnal im I M Sechenova Vol 83(1-2) Jan-Feb 1997, 150-154.
  • Turner, L. H., Lim, C. E., & Heinrichs, S. C. (2007). Antisocial and seizure susceptibility phenotypes in an animal model of epilepsy are normalized by impairment of brain corticotropin-releasing factor: Epilepsy & Behavior Vol 10(1) Feb 2007, 8-15.
  • Tyrka, A. R., Carpenter, L. L., McDougle, C. J., Kirwin, P. D., Owens, M. J., Nemeroff, C. B., et al. (2004). Increased cerebrospinal fluid corticotropin-releasing factor concentrations during tryptophan depletion in healthy adults: Biological Psychiatry Vol 56(7) Oct 2004, 531-534.
  • Ur, E., White, P. D., & Grossman, A. (1992). Hypothesis: Cytokines may be activated to cause depressive illness and chronic fatigue syndrome: European Archives of Psychiatry and Clinical Neuroscience Vol 241(5) May 1992, 317-322.
  • Valdez, G. R. (2004). Restoration of homeostasis within the stress system: A novel therapeutic approach for alcohol dependence. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Valdez, G. R. (2006). Development of CRF-sub-1 Receptor Antagonists as Antidepressants and Anxiolytics: Progress to Date: CNS Drugs Vol 20(11) 2006, 887-896.
  • Valdez, G. R., Inoue, K., Koob, G. F., Rivier, J., Vale, W., & Zorrilla, E. P. (2002). Human urocortin II: Mild locomotor suppressive and delayed anxiolytic-like effects of a novel corticotropin-releasing factor related peptide: Brain Research Vol 943(1) Jul 2002, 142-150.
  • Valdez, G. R., & Koob, G. F. (2004). Allostasis and dysregulation of corticotropin-releasing factor and neuropeptide Y systems: Implications for the development of alcoholism: Pharmacology, Biochemistry and Behavior Vol 79(4) Dec 2004, 671-689.
  • Valdez, G. R., Roberts, A. J., Chan, K., Davis, H., Brennan, M., Zorrilla, E. P., et al. (2002). Increased ethanol self-administration and anxiety-like behavior during acute ethanol withdrawal and protracted abstinence: Regulation by corticotropin-releasing factor: Alcoholism: Clinical and Experimental Research Vol 26(10) Oct 2002, 1494-1501.
  • Valdez, G. R., Sabino, V., & Koob, G. F. (2004). Increased Anxiety-Like Behavior and Ethanol Self- Administration in Dependent Rats: Reversal via Corticotropin-Releasing Factor-2 Receptor Activation: Alcoholism: Clinical and Experimental Research Vol 28(6) Jun 2004, 865-872.
  • Valdez, G. R., Zorrilla, E. P., Roberts, A. J., & Koob, G. F. (2003). Antagonism of corticotropin-releasing factor attenuates the enhanced responsiveness to stress observed during protracted ethanol abstinence: Alcohol Vol 29(2) Feb 2003, 55-60.
  • Van Bockstaele, E. J., Peoples, J., & Valentino, R. J. (1999). Anatomic basis for differential regulation of the rostrolateral peri-locus coeruleus region by limbic afferents: Biological Psychiatry Vol 46(10) Nov 1999, 1352-1363.
  • Van Den Eede, F., Van den Bossche, B., Hulstijn, W., Sabbe, B. G. C., Cosyns, P., & Claes, S. J. (2006). Combined dexamethasone/CRF test in remitted outpatients with recurrent major depressive disorder: Journal of Affective Disorders Vol 93(1-3) Jul 2006, 259-263.
  • Van Den Eede, F., Venken, T., Van Den Bogaert, A., Del-Favero, J., Norrback, K.-F., Nilsson, L. G., et al. (2007). Single nucleotide polymorphism analysis of corticotropin-releasing factor-binding protein gene in bipolar disorder: Psychiatric Genetics Vol 17(5) Oct 2007, 304-307.
  • van Gaalen, M. M., Reul, J. H. M., Gesing, A., Stenzel-Poore, M. P., Holsboer, F., & Steckler, T. (2002). Mice overexpressing CRH show reduced responsiveness in plasma corticosterone after a 5-HT-sub(1A) receptor challenge: Genes, Brain & Behavior Vol 1(3) Aug 2002, 174-177.
  • van Gaalen, M. M., Stenzel-Poore, M., Holsboer, F., & Steckler, T. (2003). Reduced attention in mice overproducing corticotropin-releasing hormone: Behavioural Brain Research Vol 142(1-2) Jun 2003, 69-79.
  • van Gaalen, M. M., Stenzel-Poore, M. P., Holsboer, F., & Steckler, T. (2002). Effects of transgenic overproduction of CRH on anxiety-like behavior: European Journal of Neuroscience Vol 15(12) Jun 2002, 2007-2015.
  • van Gaalen, M. M., Stenzel-Poore, M. P., Holsboer, F., & Steckler, T. (2002). Effects of transgenic overproduction of CRH on anxiety-like behaviour: Corrigendum: European Journal of Neuroscience Vol 16(7) Oct 2002, 1407.
  • VanEekelen, J. A. M., Oitzl, M. S., & De Kloet, E. R. (1995). Adrenocortical hyporesponsiveness and glucocorticoid feedback resistance in old male brown Norway rats: Journals of Gerontology: Series A: Biological Sciences and Medical Sciences Vol 50A(2) Mar 1995, B83-B89.
  • Vaughan, J., Donaldson, C., Bittencourt, J., Perrin, M. H., & et al. (1995). Urocortin, a mammalian neuropeptide related to fish urotensin I and to corticotropin-releasing factor: Nature Vol 378(6554) Nov 1995, 287-292.
  • Vazquez, D. M., Eskandari, R., Phelka, A., & Lopez, J. F. (2003). Impact of maternal deprivation on brain corticotropin-releasing hormone circuits: Prevention of CRH receptor-2 mRNA changes by desipramine treatment: Neuropsychopharmacology Vol 28(5) May 2003, 898-909.
  • Venihaki, M., Sakihara, S., Subramanian, S., Dikkes, P., Weninger, S. C., Liapakis, G., et al. (2004). Urocortin III, A Brain Neuropeptide of the Corticotropin Releasing Hormone Family: Modulation by Stress and Attenuation of Some Anxiety-Like Behaviours: Journal of Neuroendocrinology Vol 16(5) May 2004, 411-422.
  • Vergoni, A. V., Bertolini, A., Wikberg, J. E. S., & Schioth, H. B. (1999). Corticotropin-releasing factor (CRF) induced anorexia is not influenced by a melanocortin 4 receptor blockage: Peptides Vol 20(4) 1999, 509-513.
  • Vieta, E., Gasto, C., Martinez de Osaba, M. J., Nieto, E., Canto, T. J., Otero, A., et al. (1997). Prediction of depressive relapse in remitted bipolar patients using corticotrophin-releasing hormone challenge test: Acta Psychiatrica Scandinavica Vol 95(3) Mar 1997, 205-211.
  • Vinkers, C. H., Risbrough, V. B., Geyer, M. A., Caldwell, S., Low, M. J., & Hauger, R. L. (2007). Role of dopamine D-sub-1 and D-sub-2 receptors in CRF-induced disruption of sensorimotor gating: Pharmacology, Biochemistry and Behavior Vol 86(3) Mar 2007, 550-558.
  • Vit, J.-P., Clauw, D. J., Moallem, T., Boudah, A., Ohara, P. T., & Jasmin, L. (2006). Analgesia and hyperalgesia from CRF receptor modulation in the central nervous system of Fischer and Lewis rats: Pain Vol 121(3) Apr 2006, 241-260.
  • Walsh, P., Spelman, L., Sharifi, N., & Thakore, J. H. (2005). Male patients with paranoid schizophrenia have greater ACTH and cortisol secretion in response to metoclopramide-induced AVP release: Psychoneuroendocrinology Vol 30(5) Jun 2005, 431-437.
  • Waltman, C., McCaul, M. E., & Wand, G. S. (1994). Adrenocorticotropin responses following administration of ethanol and ovine corticotropin-releasing hormone in the sons of alcoholics and control subjects: Alcoholism: Clinical and Experimental Research Vol 18(4) Aug 1994, 826-830.
  • Wanat, M. J. (2008). The excitatory actions of corticotropin-releasing factor on ventral tegmental area dopamine neurons. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Wang, B., Shaham, Y., Zitzman, D., Azari, S., Wise, R. A., & You, Z.-B. (2005). Cocaine Experience Establishes Control of Midbrain Glutamate and Dopamine by Corticotropin-Releasing Factor: A Role in Stress-Induced Relapse to Drug Seeking: Journal of Neuroscience Vol 25(22) Jun 2005, 5389-5396.
  • Ward, H. E., Johnson, E. A., Goodman, I. J., Birkle, D. L., Cottrell, D. J., & Azzaro, A. J. (1998). Corticotropin-releasing factor and defensive withdrawal: Inhibition of monoamine oxidase prevents habituation to chronic stress: Pharmacology, Biochemistry and Behavior Vol 60(1) May 1998, 209-215.
  • Ward, H. E., Johnson, E. A., Salm, A. K., & Birkle, D. L. (2000). Effects of prenatal stress on defensive withdrawal behavior and corticotropin releasing factor systems in rat brain: Physiology & Behavior Vol 70(3-4) Aug-Sep 2000, 359-366.
  • Watts, A. G., Kelly, A. B., & Sanchez-Watts, G. (1995). Neuropeptides and thirst: The temporal response of corticotropin-releasing hormone and neurotensin/neuromedin N gene expression in rat limbic forebrain neurons to drinking hypertonic saline: Behavioral Neuroscience Vol 109(6) Dec 1995, 1146-1157.
  • Webster, E. L., Torpy, D. J., Elenkov, I. J., & Chrousos, G. P. (1998). Corticotropin-releasing hormone and inflammation. New York, NY: New York Academy of Sciences.
  • Weinstock, M. (2000). Behavioral and neurohormonal sequelae of prenatal stress: A suggested model of depression. New York, NY: Kluwer Academic/Plenum Publishers.
  • Weiss, J. M., Stout, J. C., Aaron, M. F., Quan, N., & et al. (1994). Depression and anxiety: Role of the locus coeruleus and corticotropin-releasing factor: Brain Research Bulletin Vol 35(5-6) 1994, 561-572.
  • Weitemier, A. Z., & Ryabinin, A. E. (2005). Brain region-specific regulation of urocortin 1 innervation and corticotropin-releasing factor receptor type 2 binding by ethanol exposure: Alcoholism: Clinical and Experimental Research Vol 29(9) Sep 2005, 1610-1620.
  • Westrin, A., Ekman, R., Regnell, G., & Traskman-Bendz, L. (2001). A follow up study of suicide attempters: Increase of SCF-somatostatin but no change in CSF-CRH: European Neuropsychopharmacology Vol 11(2) Apr 2001, 135-143.
  • Westrin, A., Ekman, R., & Traskman-Bendz, L. (1999). Alterations of corticotropin releasing hormone (CRH) and neuropeptide Y (NPY) plasma levels in mood disorder patients with recent suicide attempt: European Neuropsychopharmacology Vol 9(3) Mar 1999, 205-211.
  • Wichniak, A., Brunner, H., Ising, M., Gil, F. P., Holsboer, F., & Friess, E. (2004). Impaired hypothalamic-pituitary-adrenocortical (HPA) system is related to severity of benzodiazepine withdrawal in patients with depression: Psychoneuroendocrinology Vol 29(9) Oct 2004, 1101-1108.
  • Wiedemann, K., & Holsboer, F. (1997). The effect of repeated human corticotropin-releasing hormone administration on dexamethasone-suppressed pituitary-adrenocortical activity in healthy subjects: Biological Psychiatry Vol 42(10) Nov 1997, 882-888.
  • Wiedenmayer, C. P., Magarinos, A. M., McEwen, B. S., & Barr, G. A. (2005). Age-specific threats induce CRF expression in the paraventricular nucleus of the hypothalamus and hippocampus of young rats: Hormones and Behavior Vol 47(2) Feb 2005, 139-150.
  • Wiersma, A., Baauw, A. D., Bohus, B., & Koolhaas, J. M. (1995). Behavioural activation produced by CRH but not !a-helical CRH (CRH-receptor antagonist) when microinfused into the central nucleus of the amygdala under stress-free conditions: Psychoneuroendocrinology Vol 20(4) 1995, 423-432.
  • Wiersma, A., Bohus, B., & Koolhaas, J. M. (1996). Corticotropin-releasing hormone microinfusion in the central amygdala enhances active behaviour responses in the conditioned defensive burying paradigm: Stress: The International Journal on the Biology of Stress Vol 1(2) Sep 1996, 113-122.
  • Wiersma, A., Knollema, S., Konsman, J. P., Bohus, B., & Koolhaas, J. M. (1997). Corticotropin-releasing hormone modulation of a conditioned stress response in the central amygdala of Roman high (RHA/Verh)-avoidance and low (RLA/Verh)-avoidance rats: Behavior Genetics Vol 27(6) Nov 1997, 547-555.
  • Wiersma, A., Konsman, J. P., Knollema, S., Bohus, B., & Koolhaas, J. M. (1998). Differential effects of CRH infusion into the central nucleus of the amygdala in the Roman high avoidance and low avoidance rats: Psychoneuroendocrinology Vol 23(3) Apr 1998, 261-274.
  • Wilbert-Lampen, U., Trapp, A., Modrzik, M., Fiedler, B., Straube, F., & Plasse, A. (2006). Effects of corticotropin-releasing hormone (CRH) on endothelin-1 and NO release, mediated by CRH receptor subtype R2: A potential link between stress and endothelial dysfunction? : Journal of Psychosomatic Research Vol 61(4) Oct 2006, 453-460.
  • Williams, M. T., Davis, H. N., McCrea, A. E., & Hennessey, M. B. (1998). The distribution of radiolabeled corticotropin-releasing factor in pregnant rats: An investigation of placental transfer to the fetuses: International Journal of Developmental Neuroscience Vol 16(3-4) Jun-Jul 1998, 229-234.
  • Williams, M. T., Hennessy, M. B., & Davis, H. N. (1995). CRF administered to pregnant rats alters offspring behavior and morphology: Pharmacology, Biochemistry and Behavior Vol 52(1) Sep 1995, 161-167.
  • Winsky-Sommerer, R., Yamanaka, A., Diano, S., Borok, E., Roberts, A. J., Sakurai, T., et al. (2004). Interaction between the Corticotropin-Releasing Factor System and Hypocretins (Orexins): A Novel Circuit Mediating Stress Response: Journal of Neuroscience Vol 24(50) Dec 2004, 11439-11448.
  • Wong, M.-L., Webster, E. L., Spokes, H., Phu, P., Ehrhart-Bornstein, M., Bornstein, S., et al. (1999). Chronic administration of the non-peptide CRH type 1 receptor antagonist antalarmin does not blunt hypothalamic-pituitary-adrenal axis responses to acute immobilization stress: Life Sciences Vol 65(4) Jun 1999, PL53-PL58.
  • Wood, S. K., Verhoeven, R. E., Savit, A. Z., Rice, K. C., Fischbach, P. S., & Woods, J. H. (2006). Facilitation of Cardiac Vagal Activity by CRF-RI Antagonists during Swim Stress in Rats: Neuropsychopharmacology Vol 31(12) Dec 2006, 2580-2590.
  • Wu, J.-S., Ku, Y.-H., Li, L.-S., Lu, Y.-C., Ding, X., & Wang, Y.-G. (1999). Corticotropin releasing factor and substance P mediate the nucleus amygdaloideus centralis-nucleus ventromedialis-nucleus dorsomedialis pressor system: Brain Research Vol 842(2) Sep 1999, 392-398.
  • Xu, J.-F., Chen, X.-Q., & Du, J.-Z. (2006). CRH receptor type 1 mediates continual hypoxia-induced changes of immunoreactive prolactin and prolactin mRNA expression in rat pituitary: Hormones and Behavior Vol 49(2) Feb 2006, 181-189.
  • Yamada, K., Shibasaki, T., Tsumori, C., Imaki, T., & et al. (1996). Neuropeptide Y reverses corticotropin-releasing hormone- and psychological stress-caused shortening of sodium pentobarbital-induced sleep in rats: Brain Research Vol 725(2) Jul 1996, 272-275.
  • Yamano, M., Yuki, H., Yasuda, S., & Miyata, K. (2000). Corticotropin-releasing hormone-sub-1 receptors mediate consensus interferon-alpha YM643-induced depression-like behavior in mice: Journal of Pharmacology and Experimental Therapeutics Vol 292(1) Jan 2000, 181-187.
  • Yang, M., Farrokhi, C., Vasconcellos, A., Blanchard, R. J., & Blanchard, D. C. (2006). Central infusion of ovine CRF (oCRF) potentiates defensive behaviors in CD-1 mice in the Mouse Defense Test Battery (MDTB): Behavioural Brain Research Vol 171(1) Jul 2006, 1-8.
  • Yao, M., Westphal, N. J., & Denver, R. J. (2004). Distribution and Acute Stressor-Induced Activation of Corticotrophin-Releasing Hormone Neurones in the Central Nervous System of Xenopus Iaevis: Journal of Neuroendocrinology Vol 16(11) Nov 2004, 880-893.
  • Yi, P.-L., Tsai, C.-H., Lin, J.-G., Lee, C.-C., & Chang, F.-C. (2004). Kindling Stimuli Delivered at Different Times in the Sleep-Wake Cycle: Sleep: Journal of Sleep and Sleep Disorders Research Vol 27(2) 2004, 203-212.
  • Yokota, M., Ozaki, Y., Sakamoto, F., Yamada, S., Saito, J., Fujihara, H., et al. (2004). Fos expression in CRF-containing neurons in the rat paraventricular nucleus after central administration of neuromedin U: Stress: The International Journal on the Biology of Stress Vol 7(2) Jun 2004, 109-112.
  • Yoshida-Hiroi, M., Bradbury, M. J., Eisenhofer, G., Hiroi, N., Vale, W. W., Novotny, G. E., et al. (2002). Chromaffin cell function and structure is impaired in corticotropin-releasing hormone receptor type 1-null mice: Molecular Psychiatry Vol 7(9) 2002, 967-974.
  • Young, E. A., Akil, Y., Haskett, R. F., & Watson, S. J. (1995). Evidence against changes in corticotroph CRF receptors in depressed patients: Biological Psychiatry Vol 37(6) Mar 1995, 355-363.
  • Yu, B. N. (2000). Corticotropin releasing factor (CRF) and leptin contributions to energy balance in genetically obese lep-ob/lep-ob mice: Possible involvement of CRF in the leptin effects. Dissertation Abstracts International: Section B: The Sciences and Engineering.
  • Zeng, J., Kitayama, I., Yoshizato, H., Zhang, K., & Okazaki, Y. (2003). Increased expression of corticotropin-releasing factor receptor mRNA in the locus coeruleus of stress-induced rat model of depression: Life Sciences Vol 73(9) Jul 2003, 1131-1139.
  • Zhang, R., Tachibana, T., Takagi, T., Koutoku, T., Denbow, D. M., & Furuse, M. (2004). Serotonin modifies corticotropin-releasing factor-induced behaviors of chicks: Behavioural Brain Research Vol 151(1-2) May 2004, 47-52.
  • Zhou, Y., Spangler, R., Ho, A., & Kreek, M. J. (2003). Increased CRH mRNA levels in the rat amygdala during short-term withdrawal from chronic 'binge' cocaine: Molecular Brain Research Vol 114(1) May 2003, 73-79.
  • Zhou, Y., Spangler, R., LaForge, K. S., & Maggos, C. E. (1996). Corticotropin-releasing factor and type 1 corticotropin-releasing factor receptor messenger RNAs in rat brain nad pituitary during "Binge"-pattern cocaine administration and chronic withdrawl: Journal of Pharmacology and Experimental Therapeutics Vol 279(1) Oct 1996, 351-358.
  • Zhou, Y., Spangler, R., Schlussman, S. D., Ho, A., & Kreek, M. J. (2003). Alterations in hypothalamic-pituitary-adrenal axis activity and in levels of proopiomelanocortin and corticotropin-releasing hormone-receptor 1 mRNAs in the pituitary and hypothalamus of the rat during chronic "binge" cocaine and withdrawal: Brain Research Vol 964(2) Feb 2003, 187-199.
  • Zhou, Y., Spangler, R., Yuferov, V. P., Schlussmann, S. D., Ho, A., & Kreek, M. J. (2004). Effects of selective Dl- or D2-like dopamine receptor antagonists with acute "binge" pattern cocaine on corticotropin-releasing hormone and proopiomelanocortin mRNA levels in the hypothalamus: Molecular Brain Research Vol 130(1-2) Nov 2004, 61-67.
  • Zimmerman, U., Spring, K., Koller, G., Holsboer, F., & Soyka, M. (2004). Hypothalamic-pituitary-adrenal system regulation in recently detoxified alcoholics is not altered by one week of treatment with acamprosate: Pharmacopsychiatry Vol 37(3) May 2004, 98-102.
  • Zobel, A. W., Nickel, T., Kunzel, H. E., Ackl, N., Sonntag, A., Ising, M., et al. (2000). Effects of high-affinity corticotropin-releasing hormone receptor 1 antagonist R121919 in major depression: The first 20 patients treated: Journal of Psychiatric Research Vol 34(3) May-Jun 2000, 171-181.
  • Zorrilla, E. P., Reinhardt, L. E., Valdez, G. R., Inoue, K., Rivier, J. E., Vale, W. W., et al. (2004). Human Urocortin 2, a Corticotropin-Releasing Factor (CRF)-sub-2 Agonist, and Ovine CRF, a CRF-sub-1, Agonist, Differentially Alter Feeding and Motor Activity: Journal of Pharmacology and Experimental Therapeutics Vol 310(3) Sep 2004, 1027-1034.
  • Zorrilla, E. P., Schulteis, G., Ling, N., Koob, G. F., & De Souza, E. B. (2001). Performance-enhancing effects of CRF-BP ligand inhibitors: Neuroreport: For Rapid Communication of Neuroscience Research Vol 12(6) May 2001, 1231-1234.
  • Zorrilla, E. P., Valdez, G. R., Nozulak, J., Koob, G. F., & Markou, A. (2002). Effects of antalarmin, a CRF type 1 receptor antagonist, on anxiety-like behavior and motor activation in the rat: Brain Research Vol 952(2) Oct 2002, 188-199.
  • Zorrilla, E. P., Valdez, G. R., & Weiss, F. (2001). Changes in levels of regional CRF-like-immunoreactivity and plasma corticosterone during protracted drug withdrawal in dependent rats: Psychopharmacology Vol 158(4) Dec 2001, 374-381.


|}

Target-derived NGF, BDNF, NT-3

|}


This page uses Creative Commons Licensed content from Wikipedia (view authors).
Advertisement